KEGG   Staphylococcus saprophyticus: SSP1521Help
Entry
SSP1521           CDS       T00269                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00020  Citrate cycle (TCA cycle)
ssp00640  Propanoate metabolism
ssp00660  C5-Branched dibasic acid metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
Module
ssp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSP1521
   00640 Propanoate metabolism
    SSP1521
   00660 C5-Branched dibasic acid metabolism
    SSP1521
Enzymes [BR:ssp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SSP1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: BAE18666
UniProt: Q49X32
Position
complement(1581490..1582656)
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKAIFRSMGVAVPEGRVAYTAEEAVEKAKELDSKVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCDIQKEYYVGFVIDRATDR
VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVVGLAPYQARRIAFNINIPKESINKAAKF
LVSLYNVFIEKDCSIVEINPLVTTGEGEVLALDAKVNFDDNALFKHKDIQELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDENVKGIFVNIFGGIMKCDIIAEGIVAAVKEVELTLPLVVRLEGTNVERGKEI
LKESGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagcaatatttcgttctatgggcgttgctgtccca
gaaggacgcgtagcatatactgctgaagaagcagtagaaaaagcaaaagaattagattca
aaagtttacgtggttaaagcacagattcacgcagggggcagagggaaagcaggcggtgtt
aaaatcgctaaatctctttctgaagttgaaacttatgctaaagaattattaggtaaaaca
cttgttacacatcaaactggtccagaaggtaaagaaattaaacgcctttacatagaagag
ggctgcgatattcaaaaagaatattatgttggttttgtcatcgatcgtgcgacagataga
gttactttgatggcttcagaagaaggcggtactgaaattgaagaggttgctgctaaaaca
cctgaaaaaatattcaaagaaacaattgatcctgttgtaggattagcaccatatcaagct
agaagaattgcttttaacattaatattcctaaagaatctataaataaagcagctaaattt
ttagtatcactttataatgttttcatcgaaaaagattgctcaatcgttgaaatcaaccca
cttgttactacgggtgagggtgaagttttagcattagatgctaaagttaattttgatgat
aacgcattatttaaacataaagatattcaagaattacgtgatttagaagaagaagatcca
aaagaaatcgaagcttctaaatacgatttatcatatatcgctttagatggtgatattggt
tgtatggttaacggcgctggtttagcaatggcaactatggatacaatcaatcacttcggc
ggtaatccggctaacttccttgacgtagggggcggcgcaactaaagaaaaagttactgaa
gcatttaaaattatcttaggtgatgaaaatgtaaaaggtatctttgtaaatatctttggt
ggcattatgaaatgtgacattatcgctgaaggtattgttgctgcagttaaagaagtcgag
cttactttaccacttgtcgtacgtttagaaggtacaaatgttgaaagaggtaaagaaatt
cttaaagaatctggattagcaattgaaccagcagctacaatggctgaaggcgcacaaaaa
atcgtaaaacttgttaaagaagcataa

DBGET integrated database retrieval system