KEGG   Staphylococcus saprophyticus: SSP2175Help
Entry
SSP2175           CDS       T00269                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSP2175
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SSP2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2234117..2235061
Genome map
AA seq 314 aa AA seqDB search
MKNNIYGNVPCFLNSKNLNQTNTLDTDVIVYGAPFEGESTWGDYTGVELGPKQIRVCSAR
YSQYLPELNHIDISEHLTMGDVGDVPFVAHDNKQSYDNISDFAKKLWDSGKFLVGFGGEH
GVTYPILKALTETGKKVGIIHLDAHYDNMPDYEGEPYARNTPFMRLYETDGIRNESIIHT
GIHGPRNKPETGRFAQEAGAVTLTINDIRAAKDLKTYAHEIYAQASKDVDVVYLTICSDV
LDFAFNPGGPVDGNGLSSYELLTMIHEFGKLGLGGMDYVEVYPMMDANQNSAHFVSTAVL
YVLAGHVAYLNQTK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaatatttatggtaatgtaccgtgttttttaaatagtaagaatctcaatcag
acaaatacattagatacagacgtcatcgtttatggcgcaccatttgaaggtgaaagtact
tggggcgattatacgggtgtagaattgggcccgaaacaaattcgtgtttgttcagctcgc
tatagtcaatatttacctgagctcaatcacattgatatcagtgaacacctaacgatggga
gacgttggtgatgtgccctttgtagcacacgataataaacaaagttacgacaatattagt
gatttcgctaaaaagctttgggatagtggtaaattcttagttggctttggtggagagcat
ggtgtgacatatccaatactgaaagcactaacggaaacaggcaaaaaagtaggcatcatt
catttagatgcgcactatgacaacatgcctgattacgaaggtgaaccttatgcgcgtaac
accccttttatgagactttatgaaacggatggtatacgcaacgaaagtattattcacact
ggtatacacggtcctagaaataagcctgaaactggtcgcttcgcacaagaagctggtgca
gtaactttaactattaatgatattcgagcggctaaagacttgaaaacatatgcacacgaa
atctacgcgcaagcgagcaaggatgtagatgttgtctacctaactatctgtagtgatgta
cttgacttcgcctttaatcctggtggtcctgtcgatggtaatgggttatcttcttatgaa
ctccttacgatgattcatgaattcggaaaactagggcttggtggcatggactacgtggaa
gtatatcctatgatggatgccaatcaaaactcagctcattttgtctctacagcagtgtta
tatgtacttgctggccacgtcgcttatttaaatcaaacaaaataa

DBGET integrated database retrieval system