KEGG   Staphylococcus saprophyticus: SSP2261Help
Entry
SSP2261           CDS       T00269                                 

Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00900  Terpenoid backbone biosynthesis
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSP2261
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SSP2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAE19406
UniProt: Q49V04
Position
complement(2337151..2337999)
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINLTLDTLFKRDDGFHEVEMIMTTIDLNDRLSFELRKDKKIVVDVEQTYVP
SDNKNLAYKAAELMKKTYNLQQGLTITIDKNIPVSAGLAGGSTDAAATMRGMNRLYKLNR
PLEELCALGIQIGTDIPFCILGKTALCKGKGEIIEYLDKPPSAWVVVAKPDLGISSPDIF
KKLDLTQPHTVHTEACENALISGDYEQLCKSLSNRLEPVSGKMHDEILKIKANMLENGAD
GAVMSGSGPTVYALARKERQARHIYNAVNGCCNEVHIVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaaactgcgccagctaaaattaacttaacgttggacacactctttaaacga
gatgatggttttcatgaagttgaaatgataatgacaacgatagatttaaacgatcgctta
tcatttgaactgcgtaaagacaaaaaaatagttgttgacgtagaacagacttatgttccc
tccgataataaaaatttggcatataaagctgcagaactaatgaaaaagacctataattta
caacaaggtctgaccattacgattgataaaaacatacccgtgtcagcagggttagcaggt
ggatcgacagatgctgcagctacgatgagaggcatgaatcgtttatataagttaaataga
ccgttagaggaactatgtgcattaggaatacaaattggaacggatattcctttttgtata
ttaggtaagactgctttgtgtaagggcaagggcgaaataatcgaatatttggataaaccg
ccttctgcttgggttgtggttgctaaacctgatttaggtatatcgtcaccagatatattt
aagaaattagatttaacacaaccgcatacagtgcatactgaagcatgtgaaaatgcttta
atttctggagattatgaacaattatgtaaaagtctttcaaatcgcttggaacctgtttcg
ggaaagatgcatgatgaaatattaaaaataaaagccaatatgttagaaaatggtgcggat
ggtgctgttatgagtggtagtggcccgacagtttatgcgttagctaggaaagagagacaa
gcaagacacatatataacgcggttaatggttgctgcaatgaagtacatattgtaagattg
ttaggctga

DBGET integrated database retrieval system