KEGG   Staphylococcus saprophyticus: SSP2337Help
Entry
SSP2337           CDS       T00269                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSP2337
   01230 Biosynthesis of amino acids
    SSP2337
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP2337
  Energy metabolism
   00680 Methane metabolism
    SSP2337
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSP2337
Enzymes [BR:ssp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSP2337
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSP2337
  Exosomal proteins of melanoma cells
   SSP2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418843..2419421)
Genome map
AA seq 192 aa AA seqDB search
MKIYLVRHGESQSNYDKKQGKNYFCGQLDVPLTERGTWSAQLLQSYFDKKAIDHIYISDL
LRTRQTYNAIFDKSIPASVTPLLRERSLGVFEGKIVEAVEQNSSYTRYFEDQNYLEFRHS
FTQKAPEGESYADVMERVKQFFENEIDDSLDSIAIVAHQVVIRCCFVYLGYDSEATVIDR
KIENCVPYELEK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatttggtaagacatggtgagtcacaatcaaattatgataagaaacaaggg
aaaaattatttttgtggacaattagatgtaccacttactgagagaggcacatggtcagct
caattattacagagctattttgacaaaaaagcaatagatcatatttatatttcggattta
ttacggacacgtcaaacttataatgcgatatttgataaatcgattccggcaagcgtgacc
cctttgttaagagagcgttcgcttggtgtttttgaaggtaaaattgttgaagcagtggaa
caaaattcatcttatacacgctattttgaagatcaaaattatcttgaatttcgtcacagt
tttacgcaaaaggcgccagagggagaaagttatgcggatgttatggaacgtgttaaacaa
ttttttgaaaatgaaattgatgattcactcgattccattgctatcgtagcacatcaagtt
gttatacgttgttgcttcgtatatttaggatatgattcggaagctacagtgattgataga
aaaattgaaaactgtgtaccttatgaactagaaaaatag

DBGET integrated database retrieval system