KEGG   Streptococcus suis D9: SSUD9_0177Help
Entry
SSUD9_0177        CDS       T02022                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssq  Streptococcus suis D9
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUD9_0177
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUD9_0177
   00600 Sphingolipid metabolism
    SSUD9_0177
Enzymes [BR:ssq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSUD9_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162668..164869
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHVIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEESQTRLVLSYTIFRDYPAVTRSARFEQLGEQSVCLNRAL
SMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNK
DSDLYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQNIHDQLHRLLAEHDIDYIKWDM
NRYMTEVFTCTREAERQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSTGCHVSASPNQQLGRATPLSTRANVAFFG
SFGYELDLFECSQEELEEMKEQIAFYKAHRKLFQQGIFTRLKSPFDGEITAWQVQSLDGQ
QVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSYLMVLQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcctatcagtatgtgcgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggacggtagtagcctg
tcgcactttgtgtatcaaggtcatgtgatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaagagtcgcagacccgcctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaacaatctgtctgtttgaaccgtgccttg
agtatgacactttgtctgcctgatatggactatgattggttgcatttggatggggcttgg
gggcgtgagcggcatctgcaactatcgcctcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtactaggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagagcgacctgttctcttgaataactgggaagccatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaaccgagagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggattgaacctgaaatggttaataaa
gacagcgatttataccgagcgcatccagactggattttccatcatcctcagcatagtcaa
tctcacggacgccaccaatatacgttggatttgtcaagggaggatgtttatcaaaatatt
catgaccaactccatcggctgttggctgagcatgatattgattatatcaagtgggacatg
aaccgctatatgacagaggtatttacctgcacaagggaggcggagcggcaaggggagacc
ttccatcgctatattctcaatctctaccgtttatatgatagcctgatagcggcttttccg
acggttctgtttgaatcttgttcaagtggtggagctagatttgacccgggaatgctctac
tatgcaccgcaaacctgggtcagtgatgatacggacgccatggaacgcttgaaaatccaa
tatggaacgagcatggtatatcctctaaatagcacgggttgtcatgtgtcagctagtccg
aatcagcagttggggcgtgctactccactaagcacacgtgccaatgttgcattctttgga
agttttggctatgagttggatttgtttgagtgtagccaagaagagttggaagagatgaag
gagcagattgccttttacaaggctcaccgtaagcttttccaacagggtatttttactcgg
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatccttggatggtcag
caagtcatcgtgggttattaccgtcggttaacaacggctaatctctcctatcaacgcttg
tatttgcagggattggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggagaccatgttggagacaataag
gactttacttcttatttgatggtccttcagaaacaacagtag

DBGET integrated database retrieval system