KEGG   Streptococcus suis D9: SSUD9_0411Help
Entry
SSUD9_0411        CDS       T02022                                 

Gene name
malM
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssq  Streptococcus suis D9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
394191..395699
Genome map
AA seq 502 aa AA seqDB search
MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALIYQVRRPILEKAVQAFL
QDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWEDKKVVARNEEALDKYRLE
LANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVSADSVEVWTKPQLFKLDSE
RKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIYRIHESFKLYDVLRIDHFKG
FSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPIIAEDLGNIDAKARKLLADCG
YPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNEVVNGWYNNLEPEQQEYVDAYS
NRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEESRMNMPSTIGGNWEWRMKAEDLT
QERKDFLTKMTLLYQRGNENHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcgtaccagtggaattttgatgcatattacctcacttccaggtaagtttggt
attggtacttttggacagtctgcctatgattttgtagatttcttggtggaaaccaagcaa
acctactggcagattttaccactaacaactacaagctatggagattctccttaccagtct
ttctctgctattgcaggaaatacacacttgatagactttgacctcttggttgaagatggc
ttattggcaacagaagatttccaagatgtaaattttggagataatcctgaaaaagtagac
tatgctcttatctatcaagttcgccgaccaattttggagaaggcagttcaagcattttta
caagatgataagaagaaagctgcttttctagagtttgaaaaggctaactcatcttggttg
acagattatgcggagttcatggctatcaaggaatactttggtaataaagctctccaagaa
tgggaagataaaaaagttgtagctcgcaacgaggaagctcttgataaataccgcttagaa
ttggcaaatcaaatcgactactacaaagtcacacagtatttcttcttcagccaatggaaa
caattgaaagaatatgccaacaaacaccacatcaaaatcatcggagacatgccaatctat
gtttctgctgatagcgttgaagtgtggacaaaaccccaactattcaaattggacagtgaa
cgcaagccgctttatgtagctggtgtaccagctgataacttctcggcagatggtcaatta
tggggaaatcctatttacgattggccagaacatgaaaaaacaggctataactggtggatt
tatcgtatccatgaaagtttcaaactttatgatgtccttcggattgaccacttcaaaggt
ttctcagacttctggcaagtcgatggtaaggctgaggtggcaaaagtaggtacttgggaa
ccaggtcctggctacaatctcttcaaggctgtcaaagaaacacttggagaccttccaatc
attgcagaagaccttggaaacattgacgctaaagctcgcaaattgcttgcggattgtggc
tatccaggcatgaaaatcttagaatttggtttctttgatgtaacaggtaagagtatcgat
gctccacaccgttgcattccaaattcagttgcctacactggaactcacgataatgaggtt
gtcaatggctggtacaacaatcttgagccagaacaacaagaatacgtggacgcctacagc
aaccgtaagccgattgaaaaagttagccaagctatgctccgtatgctgtttgcaacagtg
agtgatacagctattgcaaccatgcaagacgtcctagacttgggtgaagaaagtcgaatg
aatatgccgtcaactatcggtggaaactgggaatggcgcatgaaagctgaagacttgacc
caagaacgcaaagacttcttgacaaaaatgacattactataccaacgaggaaatgaaaac
catgactaa

DBGET integrated database retrieval system