KEGG   Streptococcus suis D9: SSUD9_0557Help
Entry
SSUD9_0557        CDS       T02022                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssq  Streptococcus suis D9
Pathway
ssq00010  Glycolysis / Gluconeogenesis
ssq00051  Fructose and mannose metabolism
ssq00562  Inositol phosphate metabolism
ssq01100  Metabolic pathways
ssq01110  Biosynthesis of secondary metabolites
ssq01120  Microbial metabolism in diverse environments
ssq01130  Biosynthesis of antibiotics
ssq01200  Carbon metabolism
ssq01230  Biosynthesis of amino acids
Module
ssq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD9_0557 (tpiA)
   00051 Fructose and mannose metabolism
    SSUD9_0557 (tpiA)
   00562 Inositol phosphate metabolism
    SSUD9_0557 (tpiA)
Enzymes [BR:ssq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUD9_0557 (tpiA)
Exosome [BR:ssq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUD9_0557 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUD9_0557 (tpiA)
  Exosomal proteins of melanoma cells
   SSUD9_0557 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AER16796
Position
540781..541533
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaataaaaaccctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgcacaagtttctgcagctttgaaagacttgactgctgaacaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtacaggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgtccgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system