KEGG   Streptococcus suis D9: SSUD9_0557Help
Entry
SSUD9_0557        CDS       T02022                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssq  Streptococcus suis D9
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUD9_0557 (tpiA)
   01230 Biosynthesis of amino acids
    SSUD9_0557 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD9_0557 (tpiA)
   00051 Fructose and mannose metabolism
    SSUD9_0557 (tpiA)
   00562 Inositol phosphate metabolism
    SSUD9_0557 (tpiA)
Enzymes [BR:ssq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUD9_0557 (tpiA)
Exosome [BR:ssq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUD9_0557 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUD9_0557 (tpiA)
  Exosomal proteins of melanoma cells
   SSUD9_0557 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
540781..541533
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaataaaaaccctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgcacaagtttctgcagctttgaaagacttgactgctgaacaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtacaggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgtccgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system