KEGG   Streptococcus suis D9: SSUD9_0733Help
Entry
SSUD9_0733        CDS       T02022                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ssq  Streptococcus suis D9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
727170..728246
Genome map
AA seq 358 aa AA seqDB search
MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIVLVTSGSIAAGFRRLG
FEKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQDDFADARRYQNASQAL
QVLLKQRVIPIINENDTIAIEEIKVGDNDTLSAQVASLLKADLLVLLTDVDGLYTANPNS
DPNAKHLPVITEITEDLFAMAAGAGSSNGTGGMTTKLQAAQIATKSGVPVFICSSKEDTA
LLQAVTQANRGTLFLADDHAMNQRKQWMAFYARTDAAVEVDAGAVDAMLHQGRSLLATGV
KALEGDFEVGQVVEVYSQADHRLIGKGRVKLSSKDLQDQLANGRAEGVFIHRNDWVSL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaacaattgtatttaaggtcgggacaagttctctgacccaagaaaatggc
agtctggaccgtatcaagattgctcggattaccaatcagctggctcagttgcatcagaag
ggctaccagattgtgctggtgacgtcgggctcgattgctgctggttttcggagattgggc
tttgagaaacgaccaaccaagattgcggagaagcaggcttctgcggccgttggacaaggt
ttgctgattgaggaatatacgcaaaatctgatgaaagatggcattgtgtcggctcagatt
ttgctgacccaggatgattttgcggatgccagacgttatcagaatgcctctcaagcctta
caggtcttgctgaaacaacgtgttattcctattatcaacgaaaatgataccattgccatt
gaggagattaaggtaggggacaatgatactttatctgcccaggtggcttctctcttgaaa
gcagacctcttggtactcttgacggatgtggatgggctttacacggccaatcccaacagc
gatcccaatgccaaacatttgccagtgattacggaaattacggaagatttatttgccatg
gcagcaggagctggctcgtccaacggaacaggtggcatgaccaccaaattgcaggcggcc
cagattgcgaccaagtcaggcgtgcccgtctttatctgctcttcaaaagaggataccgcc
ctcttacaggcggtcacccaagccaatcgtggaacgctctttttagctgacgaccacgcc
atgaaccaacgcaagcagtggatggccttctatgctcggacagacgcagcagttgaagtg
gatgcaggagcggttgatgccatgttgcaccagggccgcagtttgttagctactggtgtc
aaagccctggaaggcgactttgaagtgggccaggtcgtagaggtttatagccaagcagac
catcgtttgattggtaaaggacgggtcaaactgtcctccaaggacttgcaggaccagttg
gcaaatggcagagcggaaggtgtgtttattcaccgcaacgattgggtgagcttatag

DBGET integrated database retrieval system