KEGG   Streptococcus suis D9: SSUD9_0939Help
Entry
SSUD9_0939        CDS       T02022                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssq  Streptococcus suis D9
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSUD9_0939 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSUD9_0939 (pyrB)
Enzymes [BR:ssq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SSUD9_0939 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942443..943366
Genome map
AA seq 307 aa AA seqDB search
MTITNGKVSLKHLVTMETLSNEEVLGLIQRGIAFKRGEKVELDRKYYASNLFFEDSTRTH
KSFEMAELRLDMGMIDFDARTSSVNKGETLYDTILTMSALGVDICVIRHSEVDYYKQLID
SPTIQTSIVNGGDGSGQHPSQSLLDLMTIYEEFGTFEGLKIAIAGDITHSRVAKSNMQIL
KRLGAEIFFAGPEEWYAEEFDVYGQHLNIDDIVETVDVLMLLRVQHERHDGDGGFSKETY
NRLHGLTEERYKRLKDTAIVMHPAPVNRDVEIDDSLVEAPKSRIVRQMQNGVFVRMAILE
AIVNGKA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaaatggtaaagtttcactcaaacacttggttacaatggagaccctctca
aatgaagaagtattgggactcattcaacgtggtattgcttttaaacgcggtgaaaaggta
gagttggatcggaagtactatgcttctaaccttttctttgaggattcaactcggacgcat
aagtcttttgaaatggcagagcttcgtttggatatgggaatgattgactttgatgctcgt
accagctcagtcaataagggtgaaaccttgtatgataccattttgaccatgtcagcactt
ggggtagacatctgcgtgattcgtcactcggaagtggattattacaagcaattgattgat
agtcctaccattcagacttcaattgtcaatggtggtgatggttcaggtcaacacccaagc
caatccctacttgatttgatgactatttatgaagaatttggaacttttgaaggcttgaag
attgccattgcaggtgatattacacactcacgggttgctaagtccaatatgcaaattttg
aaacgtctgggagctgagattttctttgctggaccggaggaatggtacgcagaggaattt
gatgtctatggtcagcatttgaatattgatgatattgtggaaacggtagatgtactgatg
ttgctccgtgtgcaacacgagcgtcatgatggtgatggtggcttttctaaagaaacttat
aaccgtttgcatggtttaacagaggagcgctacaaacgcttgaaagatactgcaattgtt
atgcatccggctcctgttaaccgtgatgttgagattgatgattctctagttgaagcaccc
aaatcacgtattgtccgtcaaatgcagaatggtgtatttgtccggatggcgattttggaa
gcaattgtcaatggcaaggcttaa

DBGET integrated database retrieval system