KEGG   Streptococcus suis D9: SSUD9_0939Help
Entry
SSUD9_0939        CDS       T02022                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssq  Streptococcus suis D9
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssq00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942443..943366
Genome map
AA seq 307 aa AA seqDB search
MTITNGKVSLKHLVTMETLSNEEVLGLIQRGIAFKRGEKVELDRKYYASNLFFEDSTRTH
KSFEMAELRLDMGMIDFDARTSSVNKGETLYDTILTMSALGVDICVIRHSEVDYYKQLID
SPTIQTSIVNGGDGSGQHPSQSLLDLMTIYEEFGTFEGLKIAIAGDITHSRVAKSNMQIL
KRLGAEIFFAGPEEWYAEEFDVYGQHLNIDDIVETVDVLMLLRVQHERHDGDGGFSKETY
NRLHGLTEERYKRLKDTAIVMHPAPVNRDVEIDDSLVEAPKSRIVRQMQNGVFVRMAILE
AIVNGKA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaaatggtaaagtttcactcaaacacttggttacaatggagaccctctca
aatgaagaagtattgggactcattcaacgtggtattgcttttaaacgcggtgaaaaggta
gagttggatcggaagtactatgcttctaaccttttctttgaggattcaactcggacgcat
aagtcttttgaaatggcagagcttcgtttggatatgggaatgattgactttgatgctcgt
accagctcagtcaataagggtgaaaccttgtatgataccattttgaccatgtcagcactt
ggggtagacatctgcgtgattcgtcactcggaagtggattattacaagcaattgattgat
agtcctaccattcagacttcaattgtcaatggtggtgatggttcaggtcaacacccaagc
caatccctacttgatttgatgactatttatgaagaatttggaacttttgaaggcttgaag
attgccattgcaggtgatattacacactcacgggttgctaagtccaatatgcaaattttg
aaacgtctgggagctgagattttctttgctggaccggaggaatggtacgcagaggaattt
gatgtctatggtcagcatttgaatattgatgatattgtggaaacggtagatgtactgatg
ttgctccgtgtgcaacacgagcgtcatgatggtgatggtggcttttctaaagaaacttat
aaccgtttgcatggtttaacagaggagcgctacaaacgcttgaaagatactgcaattgtt
atgcatccggctcctgttaaccgtgatgttgagattgatgattctctagttgaagcaccc
aaatcacgtattgtccgtcaaatgcagaatggtgtatttgtccggatggcgattttggaa
gcaattgtcaatggcaaggcttaa

DBGET integrated database retrieval system