KEGG   Streptococcus suis D9: SSUD9_1194Help
Entry
SSUD9_1194        CDS       T02022                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
ssq  Streptococcus suis D9
Pathway
ssq00051  Fructose and mannose metabolism
ssq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SSUD9_1194
Enzymes [BR:ssq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     SSUD9_1194
    5.3.1.25  L-fucose isomerase
     SSUD9_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: AER17389
Position
complement(1196665..1198431)
Genome map
AA seq 588 aa AA seqDB search
MIQHPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTI
GRVPEATASHELFKKSNVCATITVTPCWCYGSETMDMSPDIPHAIWGFNGTERPGAVYLA
AVLASHAQKGIPAFGIYGRDVQEANDTDIPEDVKEKLLRYARAALATGLMRDTAYLSMGS
VSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRIDRGIYDPEEFERAMVWVKEHIKEGV
DLNREDLILSKEEKEKQWEFVVKMFMIGRDLMQGNPRLAELGFEEEAVGHHALVAGFQGQ
RQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNTPQIFADV
RTYWSPEAVKRVTGHTLEGNAADGFLHLINSGSCTLDGTGQASRDGKPVIKPFWELEESE
VQAMLDNTDFPPANREYFRGGGFSTRFLTKGDMPVTMVRLNLLKGVGPVLQIAEGYTLEL
PEDVHHTLDNRTDPGWPTTWFAPRLTGKGAFKSVYDVMNNWGANHGAITYGHIGADLITL
ASMLRIPVNMHNVPEEDIFRPKNWSLFGTEDLESADYRACQLLGPLHK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgatacaacatccacgtattggtattcgtccgactattgatggtcgtcgtcaaggtgta
cgagaatcacttgaagtacagacaatgaacatggctaaaagtgtggcagatcttatttca
agtacattgaaatatccagatggagaacctgtggaatgcgtgatttctccatctaccatt
ggtcgtgttccagaggctacagcttcacatgagttgttcaaaaaatcaaatgtttgtgca
acaattacagtcacaccatgctggtgttatggtagtgaaactatggatatgtctccagac
attcctcatgctatttggggatttaatgggacagaacgtccaggagctgtctatcttgca
gctgttctagcttcacatgctcaaaaaggtattccagcgtttgggatttatggaagagat
gttcaggaagctaatgatacagatattccagaagatgtcaaagaaaaacttttacgttat
gcccgtgcagctcttgcaactggtttgatgcgagatactgcttacctatcaatgggtagt
gtatcaatggggattggtggttctattgtgaatccagatttcttccaagaatacctagga
atgagaaatgagtctgtagatatgacggaatttacacgtcgtattgaccgtggtatttat
gacccagaagagttcgaacgtgctatggtttgggtaaaagaacatattaaagaaggtgtt
gacctaaatcgtgaagatttgattctctctaaagaagagaaagaaaaacaatgggaattt
gtggtaaaaatgttcatgattggtcgagatcttatgcaggggaatcctcgtttagcagaa
cttggttttgaggaagaagcagttggtcaccatgctttagtagctggttttcaaggtcaa
cgccagtggacagaccatttcccaaatggagattttatggaaactttcctcaatactcag
tttgactggaatggtattcgtaaaccatttgtatttgcaacagagaatgattcactaaat
ggtgtgtctatgctctttaattacttattgacgaataccccacaaatatttgctgacgtg
cgtacttattggagtccagaggctgttaaacgtgtaacaggacatactctagaaggtaat
gccgcagatggcttcttacatttgattaactctggctcttgtacattagatggtactggg
caagctagtcgtgatggaaaacctgttattaaaccattctgggagttggaagaaagtgaa
gtgcaggctatgcttgataacacagacttcccaccagcaaaccgcgaatacttccgtgga
ggaggattctcaactcgcttcttgacgaagggggatatgccagtaacaatggtacgtctc
aatcttttaaaaggagttggtccagtgctacaaattgcagaaggttacacacttgaactt
cctgaagatgttcaccatactttagataatcggacagatccaggatggccaactacttgg
tttgctccacgtttgacaggaaaaggtgcttttaagtctgtatatgatgtcatgaataat
tggggagctaatcacggagcgataacatatggacacattggtgcagacttgattactttg
gcttctatgttgagaattcctgtcaatatgcataatgtacctgaggaagatatctttaga
cctaaaaattggtctttatttggaacagaagatttagaatcagcggactatcgtgcatgt
cagttgttgggaccactacataagtaa

DBGET integrated database retrieval system