KEGG   Streptococcus suis D9: SSUD9_1307Help
Entry
SSUD9_1307        CDS       T02022                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssq  Streptococcus suis D9
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSUD9_1307 (folK)
Enzymes [BR:ssq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SSUD9_1307 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1293839..1294327)
Genome map
AA seq 162 aa AA seqDB search
MKHLAYLSIGGNMGNRQAYLQAALDKLASHPGCQLGLVSNIYETPAWGKTDQADFLNLAC
QVYTDLSAQDFLSACQNIEQELDRVRIEKWGQRTIDLDIIFWDEEKIQEENLIVPHPYAH
ERAFVLNPLAEIASDYRHPILKKVVSDLLAELGEQKDIKIFK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatctagcctatctcagtatcggagggaacatgggcaatcggcaagcctattta
caggcagctctagacaaattagccagtcatccaggttgccagcttggcttagtttccaat
atttatgaaactccagcttggggcaagaccgaccaggctgatttcctcaatctagcctgt
caagtgtatactgatttgtctgctcaagattttctaagcgcttgccagaacatcgaacaa
gagttggaccgagtacggattgaaaaatggggacaacggaccattgatttggatattatt
ttttgggatgaggagaagattcaagaagagaatctgattgtcccccatccctacgcccat
gaaagagcatttgttctcaaccctcttgctgagattgcttctgattaccgtcacccaatt
ttgaaaaaagtggtatcggacttgcttgcagaactaggggaacaaaaagatataaaaatt
ttcaaatag

DBGET integrated database retrieval system