KEGG   Streptococcus suis D9: SSUD9_1332Help
Entry
SSUD9_1332        CDS       T02022                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ssq  Streptococcus suis D9
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD9_1332 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUD9_1332 (murA1)
Enzymes [BR:ssq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SSUD9_1332 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1318867..1320150)
Genome map
AA seq 427 aa AA seqDB search
MDTIIVTGSKNGLKGQVEIEGAKNAVLPLLAATVLASQGQTKLTQVPILSDVYTMNNVVR
GLGVRVKFDEETKTIDIDATGKLGSETPYKYVSQMRASIVILGPILARNGYAKVSMPGGC
TIGSRPIDLYLKGLQAMGAKIKQRAGYIEASAENLQGAHIYLDFPSVGATQNLMMAATLA
QGTTVLENAAREPEIVDLAIFLNKMGAKVKGAGTETITITGVEELTGAEHQVVQDRIEAG
TFMVAAAMTGGDVLVKDAVWEHNRPLISKMLEMGVEVTEEAEGIRVRSQVDKLKPVTVKT
LPHPGFPTDMQAQFTALMAVAKGESTMIETVFENRFQHLEEMRRMDLHSEILRDTAIITG
GLALQGAQVMSTDLRASAALILAGLVAEGETIVGKLTHLDRGYYRFHEKLAALGATIERV
SGEDENG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattattgttacaggtagtaaaaacggtttgaagggacaggttgagattgag
ggggcgaagaatgccgttctgcctttattggcagcaacagttctagcaagtcaagggcaa
accaaattgactcaggttcctattttgtctgatgtctatacaatgaataatgttgtacgt
ggtctgggagttcgtgtgaaatttgacgaggaaacaaagactatcgatattgacgcaaca
ggtaaacttggtagcgaaactccttataagtatgtgagtcaaatgcgcgcctctattgtt
attcttggtccgattttggcacgcaatggttatgctaaggtttctatgccaggaggttgt
acaattggtagccgtccaattgatttgtacttaaaaggtttgcaagctatgggggctaaa
attaaacaacgagctggttatattgaagcgagtgcagagaacttgcagggagctcatatc
tatcttgatttcccaagtgttggggcaacgcaaaatttgatgatggctgcaactctggcg
cagggtacaacggtattagaaaatgcagcgcgagaacctgaaattgttgacttggctatt
ttcctaaacaaaatgggggcaaaagttaagggggcaggtacagagacgattacgattact
ggtgtagaagaattgactggcgcagaacatcaagtggtgcaagatcgtatcgaagcgggt
acctttatggtggcagcggcaatgactggtggagatgtcttggtcaaggacgctgtctgg
gagcataaccgtccactcatttctaagatgttggaaatgggagttgaggtgacggaagaa
gctgaagggattcgagttcgttcgcaagtggataagcttaaacctgtaacagtaaaaacc
ttgccccatccaggattcccaacggatatgcaggctcaatttacagctctaatggcagtt
gcaaagggtgaatctaccatgattgaaacggtatttgaaaatcgtttccagcatttggaa
gaaatgcgtcggatggatttgcattcggaaattttacgagatacagctatcatcacggga
ggacttgctctgcaaggtgctcaggttatgtctactgatttacgagcaagtgccgctttg
attctggctggtttggttgctgaaggtgaaacgattgtaggtaaattaacgcacttagat
cgaggttactatcgttttcatgagaaattagctgctttaggtgcaacgattgaacgtgtg
agtggagaagatgaaaatggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system