KEGG   Streptococcus suis D9: SSUD9_1484Help
Entry
SSUD9_1484        CDS       T02022                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssq  Streptococcus suis D9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSUD9_1484
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUD9_1484
Enzymes [BR:ssq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SSUD9_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1476184..1477527
Genome map
AA seq 447 aa AA seqDB search
MKVNTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVITGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKKGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDSPLFNSTNVINP
VKYYGFATEEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICNNCGFCRPELDYK
LTDLKEITNTSSTFAIDGQDYKINIGGLYNIYNALAAVSVAAFFGVTPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPENQITETPKLEDIMALIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactactctgcctgggaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaagattatgaagtcgttgttattactggaaccaatggtaagact
ttaacaactgccttgaccgttgggattctccaagaagcctttggagaaatcacgactaat
accagcggtgccaatatgatcacaggaattacagcaacctttttgtctgccaagaaaaat
aaaaagggcaagaagattgccgtcttggagattgacgaagcaagtcttgcccgtgtaacc
gactttatcaagccgagcctgattgttttcaccaatatcttccgtgaccagatggaccgc
tacggtgagatttataccacctaccagatgattttggacggggctgcaaaagctccgcag
gcaactattttggccaatggtgatagtccactttttaactcgacaaacgttatcaatcca
gtaaaatactacggttttgcgacggaagaacatgaacctcgtctggcccattacaatacc
gaaggcgttctctgtcctcattgccaccagattatccagtacaagctcaatacctacgct
aacttgggcagctatatctgtaacaactgtggcttttgccgaccagagctggactataag
ttgacagacttgaaagaaatcaccaatacttcttctacctttgccattgacggtcaggat
tacaaaatcaacatcggaggcctctacaacatctacaatgccctagcagctgtcagcgta
gcagcatttttcggtgtaactcctgaaaaaatcaaggcaggttttgacaagtccaaggca
gtcttcggtcgccaagaaaccttcaagctgggtgataaagattgtacactggtcttgatt
aaaaacccggtcggtgcgactcaggctattgaaatgatgaaactggctccatacgatttt
agcctgtccgtccttctcaatgccaactacgctgacggaattgataccagctggatttgg
gacgctgactttgaacaaatcactcaaatggacattccacaagtctttgcaggtggtgtc
cgctcgtctgaaatcgcccgtcgcctccgtgtgactggctatcctgagaaccagattact
gaaacaccaaaactagaagatatcatggccttgattgagcaatcgagtagccagcatgct
tatattttagctacttatacagctatgctcgaattccgtgacctgctggctcaacgccaa
gccgttggaaaggagatgaaataa

DBGET integrated database retrieval system