KEGG   Streptococcus suis D9: SSUD9_1484Help
Entry
SSUD9_1484        CDS       T02022                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssq  Streptococcus suis D9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssq00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ssq00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1476184..1477527
Genome map
AA seq 447 aa AA seqDB search
MKVNTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVITGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKKGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDSPLFNSTNVINP
VKYYGFATEEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICNNCGFCRPELDYK
LTDLKEITNTSSTFAIDGQDYKINIGGLYNIYNALAAVSVAAFFGVTPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPENQITETPKLEDIMALIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactactctgcctgggaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaagattatgaagtcgttgttattactggaaccaatggtaagact
ttaacaactgccttgaccgttgggattctccaagaagcctttggagaaatcacgactaat
accagcggtgccaatatgatcacaggaattacagcaacctttttgtctgccaagaaaaat
aaaaagggcaagaagattgccgtcttggagattgacgaagcaagtcttgcccgtgtaacc
gactttatcaagccgagcctgattgttttcaccaatatcttccgtgaccagatggaccgc
tacggtgagatttataccacctaccagatgattttggacggggctgcaaaagctccgcag
gcaactattttggccaatggtgatagtccactttttaactcgacaaacgttatcaatcca
gtaaaatactacggttttgcgacggaagaacatgaacctcgtctggcccattacaatacc
gaaggcgttctctgtcctcattgccaccagattatccagtacaagctcaatacctacgct
aacttgggcagctatatctgtaacaactgtggcttttgccgaccagagctggactataag
ttgacagacttgaaagaaatcaccaatacttcttctacctttgccattgacggtcaggat
tacaaaatcaacatcggaggcctctacaacatctacaatgccctagcagctgtcagcgta
gcagcatttttcggtgtaactcctgaaaaaatcaaggcaggttttgacaagtccaaggca
gtcttcggtcgccaagaaaccttcaagctgggtgataaagattgtacactggtcttgatt
aaaaacccggtcggtgcgactcaggctattgaaatgatgaaactggctccatacgatttt
agcctgtccgtccttctcaatgccaactacgctgacggaattgataccagctggatttgg
gacgctgactttgaacaaatcactcaaatggacattccacaagtctttgcaggtggtgtc
cgctcgtctgaaatcgcccgtcgcctccgtgtgactggctatcctgagaaccagattact
gaaacaccaaaactagaagatatcatggccttgattgagcaatcgagtagccagcatgct
tatattttagctacttatacagctatgctcgaattccgtgacctgctggctcaacgccaa
gccgttggaaaggagatgaaataa

DBGET integrated database retrieval system