KEGG   Streptococcus suis D9: SSUD9_1551Help
Entry
SSUD9_1551        CDS       T02022                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssq  Streptococcus suis D9
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssq00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssq00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1541974..1544148)
Genome map
AA seq 724 aa AA seqDB search
MNVIEIYNEKQIFHLKTREFSYIIQVLETGDLVHRYFGKKIEKFSDGNKITYLDRSFSPS
PITGDRTYSLDVLPLEYSSNGLGDFRTSALDVRNEFGVTLDLKYKEYRLYKGKKELRGLP
ASFGNQEEVESLEIDLYDQLTDITVTLQYSVFEEASYLARSATIQTGKYPCKLEKVLSAT
LDFPHQDFIVHSLAGRYAYEKEWTQTPLTKGQYSIGSIRGASSHSRTPFLALASPDASED
KGDVYAAHLVYSGNFTAFVETTAMETSRLGLGLESHYFSWQLDKDDRFQTPEVLLSYTDK
GFTGMTQNSHHFITKHLIRSSFVNKPRPILINNWEATYFEFTEEKILQLAQVASRAGIEL
FVLDDGWFGKRNNDESSLGDWKVNLDKLPNGLNGLADRINELGMKFGLWFEPEMISIDSD
LYREHPDWAIRTEGRLPIYSREQLVLDLTKQEVCDYIIDSVSSILESANISYVKWDMNRN
ITNIPEGLANDQRFEFHHRYMLGLYRVLDHLTKRFPDILFESCAGGGGRNDLGIMYYMPQ
AWASDDTDAIERLSIQEGTSLIYPTSSIGAHVSAVPNHQVGRITPLATRGNVAMMGGAFG
YELDLTKLSEKELDEISQQIETYHSIRETIQFGQLYRLKKTSNTWAANYVSQDKNQAVFT
FVKILAKPEAPLLHVRLKGLDPDALYECPQLGETFYGDELLNIGLTMPHVQKDYFSVQYI
FNKI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgattgagatttataatgaaaaacagatttttcacctgaaaacaagagaattc
tcttatatcatccaagtgttggaaacaggcgatctggttcatcgttattttgggaaaaaa
atcgaaaaatttagcgatggaaacaaaataacatatttagatcgatcgttttctccgagt
ccaattactggggataggacatactcattggatgtcctcccactcgaatattccagcaat
ggtctgggagattttagaacctcagcattagatgttcggaacgaatttggagtcactctt
gacctaaaatacaaagagtatcgattatacaaggggaaaaaagaactgaggggattacca
gcaagttttggaaatcaagaagaggtagagagtcttgaaattgatctttacgatcagttg
acagatattaccgtaacacttcagtattctgtttttgaagaagcttcctatctcgcacgg
tcagctacaattcaaactggcaaatatccatgcaaactagagaaggtcttgtctgcaacg
cttgattttccacatcaagatttcattgttcacagcttggcaggacgttatgcttatgaa
aaagagtggacacagaccccattgacaaaaggtcagtattcgattggtagcattcgaggt
gcttcaagtcactcaagaacacccttcttagcactagcctcacccgatgcaagtgaggac
aagggcgatgtttatgcagcccaccttgtctatagcggcaactttacagcatttgtcgaa
acgacagccatggaaaccagtcgtttgggactaggattggaaagtcactatttctcatgg
caattggataaggatgaccggtttcaaactccagaagttctcttatcatacactgataaa
ggatttactggtatgacacaaaatagtcatcactttatcacaaaacacctcattcgatca
tcgtttgtaaacaaaccaaggcccattttaatcaacaactgggaagcaacctattttgaa
tttacagaagaaaagattttacagttagctcaggttgcaagtcgagctggtattgaattg
tttgttctggatgatggttggtttggtaaacgaaacaatgatgaaagttcattgggcgat
tggaaagtcaatttggataagttgccaaatggtttgaatggtttagcagaccgaataaat
gagcttggtatgaaattcggattgtggtttgaaccagagatgatttctattgatagcgat
ctttatcgtgagcatcctgattgggcaattcggacagaaggacgcttaccaatctacagc
cgagaacaattagttttggatttgaccaagcaggaagtctgtgactacatcattgatagc
gtctcttccatattagaatcagccaatatttcttatgtaaaatgggatatgaaccgtaat
atcaccaatatccctgaaggtttagcaaatgaccagcgctttgagttccaccatcgttac
atgctaggtctctaccgtgtattagaccaccttacaaagcggttcccagatattcttttc
gaatcctgtgcaggcggtggaggtcgtaatgatttgggaatcatgtattacatgccacaa
gcttgggcaagtgatgatacagatgcgattgagcgcttatctattcaagaaggtaccagt
ttgatttatcctacttcttctatcggagcacatgtgtcagctgtaccaaatcatcaagtt
ggtcgtattacgccccttgctacacgaggtaatgtagctatgatgggaggagcgtttggt
tacgagctggatttaacgaaactttcggaaaaggaattggatgaaatcagtcagcagatc
gaaacctatcactccattcgtgaaactatccaattcggtcagctctaccgtctgaaaaag
acgagcaatacctgggctgccaattatgttagtcaagataagaatcaagcggtctttaca
tttgtaaaaattcttgctaagccagaagcgcctttgcttcatgttcggttgaaggggcta
gacccggatgccttgtatgaatgccctcaattgggagaaacattctacggggatgaactg
ctgaacattggtcttacaatgccacatgttcaaaaagattattttagtgtacaatatatt
tttaacaaaatctag

DBGET integrated database retrieval system