KEGG   Streptococcus suis D9: SSUD9_1607Help
Entry
SSUD9_1607        CDS       T02022                                 

Definition
putative beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssq  Streptococcus suis D9
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssq00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1586841..1588232)
Genome map
AA seq 463 aa AA seqDB search
MKKFPTNFWWGAATSGPQSEGRFYKKHKNVFDYWYDIEPEAFYEGVGPDVTSNFYNSFRE
DIAMMREVGLNSVRTSIQWTRLIDDLETNTVNQAAVEFYNQVFDCFIENGIRPIVTLHHF
DLPAELYHKYGGWESRRVVDLFVGFAEQAFKLFGDRVKDWTTHNEPIVVVLGQYLQQFHY
PKLVDGKKAVQVAYHLNLASALAIAKYRELGLDEEGGRIGIVLNLTPTYPASQAPADLEA
ARIAELWNNKLFLDPAIHGHFPEELVDILSRDKVIWKTEPGDDQILRDNTIDFLGVNFYH
PNRVQAPAISPSSVGDWKPERYFDSYALPGRRMNLDRGWEIYPEALYDIAITIRDHYNNI
QWFVSENGMGISHEERFLDENGQVQDDYRIDFIRDHLECLHHGIEEGSNCFGYHMWTPID
CWSWSNAYRNRYGLIATDIHTQVKTIKKSGEWFRMIVSQNGLS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttccaactaatttttggtggggggctgcaacttcaggtccgcaaagtgag
ggacgtttttataagaaacacaagaatgtttttgattattggtatgatattgagccagaa
gctttttacgaaggtgttggtccagatgtaacctcgaatttctacaacagtttccgtgaa
gatattgcaatgatgagagaagttggacttaatagtgttcgaacgtctattcagtggact
cgtctgattgatgatttggaaaccaatactgtcaatcaggctgctgttgagttttataat
caggtgtttgactgttttattgaaaatgggattagaccaattgtaacattgcatcacttt
gatctaccagcagaattgtatcataaatatggaggttgggaatctcgacgtgttgttgac
ctgtttgttggttttgctgaacaagcattcaaactctttggtgatcgagtaaaggattgg
acaactcataatgagccaattgttgttgtgttaggtcaatatctgcaacagtttcactat
ccaaaactcgttgatggaaaaaaagctgtacaagtcgcttaccatttgaatcttgcttcg
gcactagcaattgcaaaatatcgtgaattaggtcttgatgaagaaggaggtcgtattgga
attgttctaaacttgactccgacttatccagcctcacaagcaccagcagatttggaagca
gcacggattgctgaattgtggaataataaattattccttgatcctgctatccatgggcat
tttccagaggaattagttgacatattatcaagagataaagtcatttggaagacggaacca
ggtgatgaccaaatattaagagataatactatcgattttttgggggtaaatttctatcac
ccaaatcgggttcaagctccagctatttctccaagttcagtaggcgactggaagcctgaa
cgatactttgatagttacgcattacctgggcgtagaatgaatttggatcgtggttgggaa
atttatccagaagcactgtatgatattgcaatcactattcgtgaccattataataatatt
caatggtttgtctcagagaatggtatggggatttctcatgaagaacgttttttagatgag
aatggtcaagtacaagatgactatcggatagactttatccgagatcatctagaatgctta
caccatggtattgaagaaggaagtaattgttttggctatcatatgtggacgccgattgat
tgttggtcttggtcaaatgcttatcggaatcgttatggtctgattgcaacagatatccat
acacaggtgaagaccattaaaaaatcaggagagtggtttagaatgattgtcagtcagaat
ggactatcataa

DBGET integrated database retrieval system