KEGG   Streptococcus suis D9: SSUD9_2048Help
Entry
SSUD9_2048        CDS       T02022                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ssq  Streptococcus suis D9
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSUD9_2048 (gltX)
Enzymes [BR:ssq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SSUD9_2048 (gltX)
Amino acid related enzymes [BR:ssq01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SSUD9_2048 (gltX)
Transfer RNA biogenesis [BR:ssq03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSUD9_2048 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2022244..2023698)
Genome map
AA seq 484 aa AA seqDB search
MTKPIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGIDWDESPETHEQYRQSERLDIYQKYVDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEYLGMSEDEKAAYIAEREAAGIVPTVRLAVNETGIYKWNDMVKGEIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDYLMKISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRRKGYMPEAVFNFIGLLGWNPGGEEEIFSR
EQFIQLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLETIFNLAKPFLEEAGRLTDKAEK
LVELYKPQLSSADEIVGLTDLFFSDFPELTAEEKEVMAGETVPTVLNALKEKLEAMTDED
FQPDNIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREKSIQHIDNM
LKSL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccaattcgtgtgcgttacgcaccaagtccaacgggacttttgcatatcgga
aatgctcgtacagcattgtttaactatctttttgcccgtcatcacggcggtactttcctt
attcgtatcgaggacacagaccgcaagcgccatgtggaagacggcgagcgttctcagctt
gaaaacctgcgttggttggggattgactgggatgagagtccagaaactcatgagcaatac
cgtcagtctgagcgtttggatatttaccaaaagtatgttgatcagctcttggcagaaggc
aaggcctacaagtcttatgtgaccgaagaagagttggcggcggagcgtgagcgtcaggaa
gctgcgggtgaaactcctcgctacatcaacgaataccttggtatgtctgaagatgaaaaa
gcggcctacatcgcagagcgtgaggcggctggcattgtcccaacggttcgcttggctgtc
aacgaaacaggtatctacaagtggaatgacatggttaagggcgaaatcgagttcgaaggt
ggcaacatcggtggtgactgggttatccagaaacgtgacggctatccaacttacaacttt
gccgtggtggtggacgattatctcatgaaaatctcgcacgttatccgtggggacgaccac
attgccaatacacccaagcagctcatggtctacgaagcacttggttgggaagcaccagaa
tttggtcacatgacgcttattatcaattctgaaactggtaaaaaactgtctaaacgtgat
actaacacccttcagttcatagaagattaccgtcgtaaaggttacatgcctgaagctgtt
ttcaactttatcggtcttttgggttggaacccgggtggcgaggaagaaatcttctcccgt
gagcaatttatccaactctttgacgagaaccgcctcagcaaatcgccagctgcctttgac
cagaagaaaatggactggatgagcaatgagtacatcaaaaatgctgatttagaaactatt
ttcaaccttgctaagccattcttggaagaagcggggcgtttgacagacaaagcagaaaaa
ttggtggaactttacaagccacaactgtcatctgcggatgaaatcgttggtttgacagac
ctcttcttctcagatttcccagaattgactgcggaagaaaaagaagtgatggcaggcgaa
acagtaccgactgttctcaatgccctcaaggaaaaattggaagccatgacggacgaagat
ttccaaccagataacatcttcccgcaaatcaaggctgtccaaaaagaaacaggcatcaag
ggcaaaaacctcttcatgccaatccgtatcgccgtttcaggcgaaatgcacggaccagag
ttgccaaacaccatttacctgctcggccgtgagaaatccatccagcatattgacaatatg
ttgaagagtttgtaa

DBGET integrated database retrieval system