KEGG   Streptococcus suis D9: SSUD9_2062Help
Entry
SSUD9_2062        CDS       T02022                                 

Definition
glucose-1-phosphate-uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssq  Streptococcus suis D9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUD9_2062
   00052 Galactose metabolism
    SSUD9_2062
   00500 Starch and sucrose metabolism
    SSUD9_2062
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD9_2062
Enzymes [BR:ssq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSUD9_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2035691..2036590
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagctgttatcccagctgcaggtttgggaacacgtttcttgcct
gctactaaggctcttgccaaggaaatgttgccaatcgttgacaagccaaccatccaattt
atcgttgaagaagccctccgttcaggtattgaagatattttggtggtcactggtaagtca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaactggttgatgagacaacaggtattcgactacacttc
attcgtcaaagccatccacgtggacttggggatgctgttcttcaagcaaaagcctttgtc
ggaaatgagccatttgttgtcatgctcggcgatgacttgatggacatcacagatacaaaa
gctgtcccattgaccaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcctgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgccattgatact
ctgaacaaaacgcaacgtgttttcgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttaatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system