KEGG   Streptococcus salivarius CCHSS3: SALIVB_0305Help
Entry
SALIVB_0305       CDS       T01580                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SALIVB_0305
  Amino acid metabolism
   00300 Lysine biosynthesis
    SALIVB_0305
Enzymes [BR:ssr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SALIVB_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283063..284436
Genome map
AA seq 457 aa AA seqDB search
MAFSSEEEQLRKFRNDEIAQHYFEVLRTLISKKSIFAQNIGLYDVAAYLGEIFSGVGAEV
TIDETYTAPFVLAKFKSPNPDAKTIIFYQHYDTVPADNDQPWTDEPFRLTVRKGYMYGRG
VDDDKGHITARLTALRKYIREVGDLPVNITFMMEGAEESASTDLEKYLEKYRDDLLPADL
LVWEQGNRNSKGQLEITGGNKGIITFDLSVESADVDIHSKFGAVIESASWYLLNAISSMR
DDQGRILIDGIYEKIVQPNEREMDLIETYAIENADSLRKIYGLKLPVLESDRRAFLKTYY
FEPALSIEGISTGYQGQGVKTILPAQARAKMEMRLVPGLTPEYVLECIKAHLKKEGFDRI
KVTFTLGEESYRSDMSDPAIVNVIELAKGFYEEGVAVLPTAAGTGPMHMIHKALGVPMAA
FGIGNANSRDHGGDENVSLADYYTHIELIKELIASYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaagtgaagaagagcagttacgaaaatttcgtaacgatgaaattgctcag
cactattttgaagttttgcggactttgatttctaaaaaatctatttttgctcaaaatatt
ggtctctatgatgtagctgcttaccttggtgagattttctctggtgttggcgcagaggtg
acaattgacgagacctatacggcaccttttgtcttggcaaaattcaagagtccaaatcca
gatgcgaaaacaattattttctatcaacactatgatacggttcctgcggataatgatcag
ccatggacagatgaacctttccgtctgacagttcgtaagggctacatgtatggtcgtggt
gttgatgatgataaggggcatattacagctcgtttgacagccttgcggaaatatattcga
gaggttggcgaccttcctgtaaatattacgtttatgatggagggcgctgaagaatctgca
tcaaccgaccttgaaaagtatttggaaaaataccgagatgacctgcttccagcagaccta
ttggtttgggagcaaggaaatcgaaatagcaaaggtcaattggaaatcacagggggcaac
aagggaattattacctttgacttgtctgtcgagagtgctgatgttgatattcattctaaa
tttggtgccgtgattgaatcggcttcatggtatttgctcaatgctatctcaagcatgaga
gatgatcagggacgtatccttattgacggcatctatgaaaagattgtccaaccaaacgaa
cgagagatggatcttatcgaaacttatgccattgaaaatgcagacagtcttcgtaagatt
tacggcttaaaactacccgttttagaaagtgaccgccgagctttcttaaaaacttactat
tttgaacctgccctttccattgaaggtatttcaacaggttatcaggggcaaggggttaag
actatcttaccagctcaagccagagctaagatggagatgcgtttggtccctggcttgacg
cctgagtacgttttggagtgtatcaaggctcacctcaaaaaagaaggatttgaccgtatc
aaggtgaccttcactcttggtgaggaaagttatcgtagtgatatgtctgatccggctatt
gtcaatgttattgagttagcaaaaggcttttatgaagaaggtgttgctgtgcttccaacg
gcagcaggtacagggcctatgcatatgattcataaggctttgggtgttcctatggcagcc
tttggtataggaaatgccaacagtcgtgaccacggtggggatgagaatgtcagcttagca
gattactacacccacattgaactaattaaggagttaattgcaagttatgagtaa

DBGET integrated database retrieval system