KEGG   Streptococcus salivarius CCHSS3: SALIVB_0578Help
Entry
SALIVB_0578       CDS       T01580                                 

Gene name
gmk
Definition
Guanylate kinase (GMP kinase) (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SALIVB_0578 (gmk)
Enzymes [BR:ssr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SALIVB_0578 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558341..558970
Genome map
AA seq 209 aa AA seqDB search
MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRAQRPGEVDGKDYFFRSRE
EFEELIRNGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLNELQERLVGRGTDSEEVIAQRIERAREEIALMSEYDYAIVNDEVPLAAERVK
RVIEAEHFRVDRVIGRYRNMISEKKLSDK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgtggacttttgattgttttttcagggccttctggtgtcggaaaaggaact
gttcgtcaggagattttttcaacacctgaccacaaatttgaatactcagtatcaatgacc
acacgtgctcaacgtcctggtgaagttgatgggaaggattatttcttccgttcgcgtgag
gaatttgaagaacttattcgtaatggtcaaatgttggagtatgctgaatatgtgggtaac
tactacggaacacctttgacttatgtcaatgaaaccttggataaaggtattgatgttttc
cttgaaatcgaagttcaaggtgcccttcaggttaagaaaaaggtcccagatgctgtcttc
atctttttgacaccaccggatttgaacgagcttcaagaacgtttggttggtcgtggaaca
gattctgaggaagttattgctcaacgtatcgagcgtgcgcgtgaagaaattgctctcatg
agcgaatacgattatgccattgttaatgacgaagtgcctttggctgctgaacgtgtcaaa
cgtgttattgaagcagaacacttccgtgttgaccgtgtgattggccgctatcgtaatatg
atttcagaaaagaaattatcagataaataa

DBGET integrated database retrieval system