KEGG   Streptococcus salivarius CCHSS3: SALIVB_0742Help
Entry
SALIVB_0742       CDS       T01580                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ssr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828293..828775)
Genome map
AA seq 160 aa AA seqDB search
MTTLYDFTVSNQANQLVSLQDYKGKVVLIVNTATGCGLTPQYQGLQELYDKYKDQGFEIL
DFPCNQFMGQAPGSAEEINTFCTLNYHTTFPRFAKIKVNGKEAEPLFDWLKQEKSGPLGA
RIEWNFTKFLINREGQVVERFSSKTDPLKMEDAIKALLNN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttatacgattttacagtttcaaatcaagccaaccagcttgtgtctctccag
gactataagggcaaggtcgtcttaatcgtcaatacagcaacaggttgtggtttgacgcca
cagtatcagggcttacaggaactctatgacaaatacaaagaccaaggtttcgagattctt
gattttccttgtaatcagtttatggggcaagcacctggcagtgctgaagaaatcaatacc
ttctgcaccctcaattaccatacaaccttccctcgttttgccaaaatcaaggtcaacggt
aaggaagcagagccactttttgattggctaaaacaagaaaaatctggaccgcttggggct
agaattgagtggaactttacaaagtttctgattaaccgtgaaggacaagtggtcgaacgc
ttttcttccaaaactgatccactaaaaatggaagatgctatcaaggctcttcttaataac
taa

DBGET integrated database retrieval system