KEGG   Streptococcus salivarius CCHSS3: SALIVB_0742Help
Entry
SALIVB_0742       CDS       T01580                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SALIVB_0742 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SALIVB_0742 (gpo)
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SALIVB_0742 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828293..828775)
Genome map
AA seq 160 aa AA seqDB search
MTTLYDFTVSNQANQLVSLQDYKGKVVLIVNTATGCGLTPQYQGLQELYDKYKDQGFEIL
DFPCNQFMGQAPGSAEEINTFCTLNYHTTFPRFAKIKVNGKEAEPLFDWLKQEKSGPLGA
RIEWNFTKFLINREGQVVERFSSKTDPLKMEDAIKALLNN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttatacgattttacagtttcaaatcaagccaaccagcttgtgtctctccag
gactataagggcaaggtcgtcttaatcgtcaatacagcaacaggttgtggtttgacgcca
cagtatcagggcttacaggaactctatgacaaatacaaagaccaaggtttcgagattctt
gattttccttgtaatcagtttatggggcaagcacctggcagtgctgaagaaatcaatacc
ttctgcaccctcaattaccatacaaccttccctcgttttgccaaaatcaaggtcaacggt
aaggaagcagagccactttttgattggctaaaacaagaaaaatctggaccgcttggggct
agaattgagtggaactttacaaagtttctgattaaccgtgaaggacaagtggtcgaacgc
ttttcttccaaaactgatccactaaaaatggaagatgctatcaaggctcttcttaataac
taa

DBGET integrated database retrieval system