KEGG   Streptococcus salivarius CCHSS3: SALIVB_0906Help
Entry
SALIVB_0906       CDS       T01580                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SALIVB_0906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_0906
  Lipid metabolism
   00071 Fatty acid degradation
    SALIVB_0906
  Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVB_0906
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVB_0906
   00626 Naphthalene degradation
    SALIVB_0906
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVB_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001439..1001798
Genome map
AA seq 119 aa AA seqDB search
MRAVVVNQASTGVEVVDHEKPAVVGHSQALVKVEYCGVCHTDLHVAHGDFSQVTRSYTRP
REGIGIVEEVGEGVETLKKGDRLSIAWFSKDVVIVNIVQLVVETLCRSVKMLVIVLMVV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagtacaggtgttgaagttgttgatcatgaaaaa
ccagcagtagttggtcatagtcaagctttggttaaagttgaatactgtggcgtttgccat
actgaccttcacgtagctcatggagactttagtcaagtaaccaggtcgtatactaggcca
cgagaaggtattggtattgtcgaagaagttggtgaaggtgttgagacacttaaaaaaggt
gaccgcctatcaatcgcttggttctcgaaggatgtggtcattgtgaatattgtacaactg
gtcgttgaaacactctgtcgttctgtgaaaatgctggttatagtgttgatggtggtatga

DBGET integrated database retrieval system