KEGG   Streptococcus salivarius CCHSS3: SALIVB_0906Help
Entry
SALIVB_0906       CDS       T01580                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ssr01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssr00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ssr00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ssr00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ssr00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001439..1001798
Genome map
AA seq 119 aa AA seqDB search
MRAVVVNQASTGVEVVDHEKPAVVGHSQALVKVEYCGVCHTDLHVAHGDFSQVTRSYTRP
REGIGIVEEVGEGVETLKKGDRLSIAWFSKDVVIVNIVQLVVETLCRSVKMLVIVLMVV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagtacaggtgttgaagttgttgatcatgaaaaa
ccagcagtagttggtcatagtcaagctttggttaaagttgaatactgtggcgtttgccat
actgaccttcacgtagctcatggagactttagtcaagtaaccaggtcgtatactaggcca
cgagaaggtattggtattgtcgaagaagttggtgaaggtgttgagacacttaaaaaaggt
gaccgcctatcaatcgcttggttctcgaaggatgtggtcattgtgaatattgtacaactg
gtcgttgaaacactctgtcgttctgtgaaaatgctggttatagtgttgatggtggtatga

DBGET integrated database retrieval system