KEGG   Streptococcus salivarius CCHSS3: SALIVB_0906Help
Entry
SALIVB_0906       CDS       T01580                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SALIVB_0906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_0906
  Lipid metabolism
   00071 Fatty acid degradation
    SALIVB_0906
  Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVB_0906
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVB_0906
   00626 Naphthalene degradation
    SALIVB_0906
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVB_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001439..1001798
Genome map
AA seq 119 aa AA seqDB search
MRAVVVNQASTGVEVVDHEKPAVVGHSQALVKVEYCGVCHTDLHVAHGDFSQVTRSYTRP
REGIGIVEEVGEGVETLKKGDRLSIAWFSKDVVIVNIVQLVVETLCRSVKMLVIVLMVV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagtacaggtgttgaagttgttgatcatgaaaaa
ccagcagtagttggtcatagtcaagctttggttaaagttgaatactgtggcgtttgccat
actgaccttcacgtagctcatggagactttagtcaagtaaccaggtcgtatactaggcca
cgagaaggtattggtattgtcgaagaagttggtgaaggtgttgagacacttaaaaaaggt
gaccgcctatcaatcgcttggttctcgaaggatgtggtcattgtgaatattgtacaactg
gtcgttgaaacactctgtcgttctgtgaaaatgctggttatagtgttgatggtggtatga

DBGET integrated database retrieval system