KEGG   Streptococcus salivarius CCHSS3: SALIVB_0909Help
Entry
SALIVB_0909       CDS       T01580                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SALIVB_0909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_0909
  Lipid metabolism
   00071 Fatty acid degradation
    SALIVB_0909
  Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVB_0909
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVB_0909
   00626 Naphthalene degradation
    SALIVB_0909
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVB_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002014..1002460
Genome map
AA seq 148 aa AA seqDB search
MAVDINQDKLALAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVVTAVSKVAFNQAIDS
VRAGGTVVAVGLPSEYMDLSIVKTVLDGIRVVGSLVGTRKDLEEAFDFGAQGLVVPVVET
VPVDTAVEVFDQMEKGEIQGRKVLDFTK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttgatatcaaccaagataaacttgctttggctaaggaatctggtgctgattta
gtggtgaacggtaaagaagttgaagatgtagcaggttatatccaagaaaaaactggtggt
acacacagtgctgttgtaacagcggtttctaaggttgctttcaaccaggctatcgatagt
gtacgtgctggtggaacagtcgttgcggttggtctcccatcagaatatatggatctctca
attgtcaaaacagttctagatggtatccgtgttgttggatctcttgtaggtacacgtaaa
gacttggaagaagcctttgacttcggtgcacaaggcttggtagtaccggttgttgaaact
gttcctgttgatacagcggtagaagtctttgatcaaatggaaaaaggtgaaattcaagga
cgtaaagtattggatttcactaagtaa

DBGET integrated database retrieval system