KEGG   Streptococcus salivarius CCHSS3: SALIVB_1192Help
Entry
SALIVB_1192       CDS       T01580                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SALIVB_1192 (pfkA)
   01230 Biosynthesis of amino acids
    SALIVB_1192 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_1192 (pfkA)
   00030 Pentose phosphate pathway
    SALIVB_1192 (pfkA)
   00051 Fructose and mannose metabolism
    SALIVB_1192 (pfkA)
   00052 Galactose metabolism
    SALIVB_1192 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SALIVB_1192 (pfkA)
Enzymes [BR:ssr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SALIVB_1192 (pfkA)
Protein phosphatases and associated proteins [BR:ssr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SALIVB_1192 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1286816..1287835)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAARAVVLKAISEGIEVFGINRGYAGMVEGDIFQLDAKGVDNI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEAIDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGAKTHHVIVVAEGVMGAEEFAAKMKEAGD
TSDLRATNIGHVVRGGSPTARDRVLASWMGAHAVDLLKQGIGGVAVGIHNEELVESPILG
TAEEGALFSLTEDGKIIVNNPHKARLDFADLNRSLSNLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggagatgcccctggtatgaacgctgccgct
cgtgcagttgttctcaaagcaatttctgaaggaattgaagtcttcggcattaaccgtgga
tacgctggtatggttgaaggagatatcttccaacttgatgccaaaggcgtagacaacatc
ctcagccgtggtggaactttccttcagtctgctcgctatcctgagtttgcccaacttgag
ggtcaacttaaaggtattgagcaacttaaaaaacatggaatcgaaggtgtagtagttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagctgtt
ggtcttccaggaactatcgataacgatatcgttggtacagactacacaattggttttgat
actgctgttgcaacagcaacagaagctatcgataagattcaagacactgctttcagtcac
ggacgtactttcgtcgttgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttctggtgcagaccaaattatcgtacctgaagaagagtatgatattaatgaa
gttgtacgtaaagttaaagaaggttacgaatcaggtgctaaaactcaccatgtaatcgta
gttgctgaaggtgtcatgggtgctgaagaatttgcagctaaaatgaaagaagctggagat
acttcagatcttcgtgcaacaaacattggacacgtggttcgtggtggttcaccaactgcg
cgtgaccgtgttcttgcttcatggatgggggcacatgcggttgacctccttaaacaaggt
attggtggtgtagctgttggtatccacaatgaagagcttgttgaaagcccaatccttggt
acagcagaagaaggagctttgttcagtcttactgaagacggtaaaattatcgtcaacaat
cctcacaaagcacgtcttgactttgcagaccttaaccgttcattgtctaacttgagctaa

DBGET integrated database retrieval system