KEGG   Streptococcus salivarius CCHSS3: SALIVB_1199Help
Entry
SALIVB_1199       CDS       T01580                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SALIVB_1199
   01230 Biosynthesis of amino acids
    SALIVB_1199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_1199
  Energy metabolism
   00680 Methane metabolism
    SALIVB_1199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SALIVB_1199
Enzymes [BR:ssr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SALIVB_1199
Exosome [BR:ssr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SALIVB_1199
  Exosomal proteins of melanoma cells
   SALIVB_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1296523..1297215)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDDKLNVVNEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaaccttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctatcgacgctggt
aaattgatcaaagaagctggtatcgaatttgatcaagcatacacttcagtattgaaacgt
gcgatcaaaacaactaacttggctcttgaagcatctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgttttg
cctccagcaatggatcgtgatgatgagcactcagcacacactgatcgtcgttatgcttca
ctagacgactcagtaattccagatgctgaaaacttgaaagttactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtaggt
gcacacggtaactcaatccgtgcccttgttaaacacatcaaacaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtattcgaatttgacgataaattg
aacgttgttaacgaatactacctcggaaaataa

DBGET integrated database retrieval system