KEGG   Streptococcus salivarius CCHSS3: SALIVB_1457Help
Entry
SALIVB_1457       CDS       T01580                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SALIVB_1457 (recR)
DNA repair and recombination proteins [BR:ssr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SALIVB_1457 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552266..1552862)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKLPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCNICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
DYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgcgaagctgattgatagcttttcaaaactccctggaatt
ggggctaaaacagcgacacgcctagctttttataccattagcatgtctgatgaagatgtc
aatgatttcgcaaaaaacctcttggcagcaaaacgtgaattgacttattgttcggtctgt
ggtcgtttgacagatgatgatccatgtaacatttgtaccgatgaaactagagaccgtact
aagattttggttgttgaagactccaaagatgtttcagctatggaaaagattcaggaatac
cgtggtctctaccatgtgcttcaagggcttatttcccctatgaatggtgttgggccagac
gatattaacctgaaaagtttgattacccgtcttatggacagcgaggttgacgaggttatc
atcgccactaatgcaacagcagatggtgaggcaacctctatgtatatttctcgtgtcctt
aaacctgcaggaatcaaggtgactcgtttagcgcgtggtttggccgtcggttctgacatt
gactatgctgatgaagtgaccttgctaagagctatcgaaaatcgaacagaattataa

DBGET integrated database retrieval system