KEGG   Streptococcus salivarius CCHSS3: SALIVB_1457Help
Entry
SALIVB_1457       CDS       T01580                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552266..1552862)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKLPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCNICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
DYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgcgaagctgattgatagcttttcaaaactccctggaatt
ggggctaaaacagcgacacgcctagctttttataccattagcatgtctgatgaagatgtc
aatgatttcgcaaaaaacctcttggcagcaaaacgtgaattgacttattgttcggtctgt
ggtcgtttgacagatgatgatccatgtaacatttgtaccgatgaaactagagaccgtact
aagattttggttgttgaagactccaaagatgtttcagctatggaaaagattcaggaatac
cgtggtctctaccatgtgcttcaagggcttatttcccctatgaatggtgttgggccagac
gatattaacctgaaaagtttgattacccgtcttatggacagcgaggttgacgaggttatc
atcgccactaatgcaacagcagatggtgaggcaacctctatgtatatttctcgtgtcctt
aaacctgcaggaatcaaggtgactcgtttagcgcgtggtttggccgtcggttctgacatt
gactatgctgatgaagtgaccttgctaagagctatcgaaaatcgaacagaattataa

DBGET integrated database retrieval system