KEGG   Streptococcus salivarius CCHSS3: SALIVB_1633Help
Entry
SALIVB_1633       CDS       T01580                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1721725..1722525)
Genome map
AA seq 266 aa AA seqDB search
MFIGKHEIAGKACIMGILNVTPDSFSDGGDFDTVEDALAQVERMIAQGAAVIDVGGESTG
PGAEFVTEEEEIARIVPVIQAIKAKYDVLISIDTYKTATARAALEAGADILNDVWAGLYD
GQMLALAAEKNVPIILMHNQKEEVYNDVTEDVCTFLSQRAQAALEAGVAKDNIWIDPGFG
FAKNVQHNIDLLKGLDKVVALGYPVLFGISRKRVVNYLLGGNTQAKDRDQGTAALSGYAV
TKGCQIVRVHNVDVNHDIVKTISGIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtttattggcaaacatgagattgcaggtaaggcctgtattatgggaatcttgaatgtc
acccctgattctttctcagatggtggcgattttgacactgtagaggatgcgttggctcag
gttgagcgtatgattgcccagggagcagccgttatcgatgtaggtggcgaatctacagga
ccaggagcagaatttgtgaccgaggaagaagagattgctcgtattgtgccagttattcag
gctatcaaggcaaaatatgatgtgctcatcagtattgatacctataagactgctactgcc
agagctgctcttgaagcaggggcagatattctaaatgacgtctgggctggactctatgat
ggtcagatgctagctttagcagctgaaaagaatgtgccgattattctcatgcataatcaa
aaagaagaagtatacaatgatgtcacagaagatgtctgtacattcctcagtcaacgagcc
caggccgccttggaagcaggagtggccaaggacaatatctggattgatccaggttttggc
tttgctaaaaatgtccaacacaatattgacctgctaaaaggcttggacaaggtcgttgcc
ttgggctatcctgttctttttggaatttctcgtaagcgagttgtgaactacctactaggt
gggaatactcaagctaaggatcgcgaccaggggacagctgccttatctggctatgcagtt
accaaaggatgtcagattgtccgtgtacataatgttgacgtcaatcatgatatcgttaag
actatttcaggaattttatga

DBGET integrated database retrieval system