KEGG   Streptococcus salivarius CCHSS3: SALIVB_1686Help
Entry
SALIVB_1686       CDS       T01580                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SALIVB_1686 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SALIVB_1686 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SALIVB_1686 (trpA)
Enzymes [BR:ssr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SALIVB_1686 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1777023..1777805)
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKDSKRGIFVPYIMAGDHAKGLDGLFETIALLENSGVSAIEVGIPWSDP
VADGPVIELAGQRSLAKDVTLTAIIKKLQEQKTQVPLVIMTYINPVYQYGIEAFVKDLAD
TSVKGLIIPDLPDEHADFITPYLKDSDIALVPLVSLTTGIDRQKQLIDGAEGFIYAVAIN
GVTGKTGNYRDDLDKHLANLTAHADIPVLTGFGVSTEEDIKRFNAVSDGVIVGSKIVRDL
HDGKEKEVAEFVTFGSHFEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactaacaaaacacctacaagctatcaaagacagtaaacgcggtattttc
gtgccttatatcatggcgggtgaccacgctaaaggcctagacggactctttgagactatc
gctctcttggaaaatagtggtgtctcagctattgaggtgggtattccatggtcagaccca
gtggctgacggtcccgttattgaacttgcaggacaacgtagtttggctaaagatgtgact
ttgacagctattatcaagaagcttcaggaacaaaaaacacaggtgcctttggttatcatg
acctacatcaacccagtttatcaatatggtattgaagcctttgttaaggacctggcagat
acatctgtcaaggggctcattattcctgatttgccagatgaacacgctgactttatcact
ccttatttgaaagacagtgatattgctctcgtgcctctggtgagcttgactacaggtatt
gaccgtcaaaaacagttgattgatggtgcagaaggctttatctacgctgttgccattaat
ggtgttacaggtaagactggtaattaccgtgatgaccttgacaaacacttggctaacttg
actgcccatgcagacattccagttctcacaggttttggtgtgtcaacagaggaagacatt
aaacgctttaacgctgtatcagacggtgttatcgtaggatcgaaaatcgtccgtgacctc
cacgacggtaaggaaaaagaagtcgctgaatttgttacattcggttcacattttgaaaaa
tag

DBGET integrated database retrieval system