KEGG   Streptococcus salivarius CCHSS3: SALIVB_1687Help
Entry
SALIVB_1687       CDS       T01580                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00260  Glycine, serine and threonine metabolism
ssr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssr01100  Metabolic pathways
ssr01110  Biosynthesis of secondary metabolites
ssr01130  Biosynthesis of antibiotics
ssr01230  Biosynthesis of amino acids
Module
ssr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SALIVB_1687 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SALIVB_1687 (trpB)
Enzymes [BR:ssr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SALIVB_1687 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCB93948
UniProt: F8LKS8
Position
complement(1777809..1779017)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDPSFQAELDDLLKNYVGRET
PLYHAKRLTDHIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggtggtcagttcgtt
ccagaaacgctgatgacagccgttattgaattggacaaggcctatcgtgaggccaaggaa
gatccaagtttccaagcggaattggatgatctcctcaaaaactatgtgggccgtgagacg
cctctttaccacgctaaacgtttgactgatcatattggtggggcacaaatttatcttaaa
cgtgaggaccttaaccacacaggtgcccacaagattaacaatgcccttggtcaagtcttg
cttgccaaacgaatgggcaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gttgcaacagcaacagccgcagcccttttcgacatggactgtacaatctatatgggtgag
gaagatgttaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttacagatggttcgcgcgtgcttaaggacgctgtaaatgctgcccttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtcctgcacca
ttcccagaaattgttcgtgacttccaatctgtcattggtcgtgaagccaaacgtcaatac
gcagagatttctggcggtaaactgcctgatgctgtgatggcatgtatcggtggtggttca
aatgctatcggtatgttttacccatttgttaatgataaatcggtagccatgtatggtgct
gaggcttctggtttgggtcttgatactgaaaaacatgccgcaacctttgccaaaggtcgt
ccaggtattcttcatggagcgcttatggatgtcctccaagatgctcatggtcaaatcatg
gaagccttctctatctcggctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaatcggccgtgcgacttacgactctattacagatgaagaagctctcgaaggt
ttcaaacttctgtcacgtttggaaggaattatccctgcccttgagtctagccatgccatt
gcccttgcgcaaaaagtggcagctaagatgtcgccagaccaaagccttatcgtctgcctc
tcaggtcgtggggacaaggacgttatgcaggttaaagaacgtttcgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system