KEGG   Streptococcus salivarius CCHSS3: SALIVB_1687Help
Entry
SALIVB_1687       CDS       T01580                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SALIVB_1687 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SALIVB_1687 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SALIVB_1687 (trpB)
Enzymes [BR:ssr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SALIVB_1687 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1777809..1779017)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDPSFQAELDDLLKNYVGRET
PLYHAKRLTDHIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggtggtcagttcgtt
ccagaaacgctgatgacagccgttattgaattggacaaggcctatcgtgaggccaaggaa
gatccaagtttccaagcggaattggatgatctcctcaaaaactatgtgggccgtgagacg
cctctttaccacgctaaacgtttgactgatcatattggtggggcacaaatttatcttaaa
cgtgaggaccttaaccacacaggtgcccacaagattaacaatgcccttggtcaagtcttg
cttgccaaacgaatgggcaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gttgcaacagcaacagccgcagcccttttcgacatggactgtacaatctatatgggtgag
gaagatgttaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttacagatggttcgcgcgtgcttaaggacgctgtaaatgctgcccttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtcctgcacca
ttcccagaaattgttcgtgacttccaatctgtcattggtcgtgaagccaaacgtcaatac
gcagagatttctggcggtaaactgcctgatgctgtgatggcatgtatcggtggtggttca
aatgctatcggtatgttttacccatttgttaatgataaatcggtagccatgtatggtgct
gaggcttctggtttgggtcttgatactgaaaaacatgccgcaacctttgccaaaggtcgt
ccaggtattcttcatggagcgcttatggatgtcctccaagatgctcatggtcaaatcatg
gaagccttctctatctcggctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaatcggccgtgcgacttacgactctattacagatgaagaagctctcgaaggt
ttcaaacttctgtcacgtttggaaggaattatccctgcccttgagtctagccatgccatt
gcccttgcgcaaaaagtggcagctaagatgtcgccagaccaaagccttatcgtctgcctc
tcaggtcgtggggacaaggacgttatgcaggttaaagaacgtttcgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system