KEGG   Streptococcus salivarius CCHSS3: SALIVB_1741Help
Entry
SALIVB_1741       CDS       T01580                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase bglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00010  Glycolysis / Gluconeogenesis
ssr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_1741 (bglA)
   00500 Starch and sucrose metabolism
    SALIVB_1741 (bglA)
Enzymes [BR:ssr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SALIVB_1741 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Imm59
Motif
Other DBs
NCBI-ProteinID: CCB94001
UniProt: F8LKY1
Position
complement(1827170..1828606)
Genome map
AA seq 478 aa AA seqDB search
MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAREITPGVLEGKYYPNH
EAIDFYHRYKGDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNEEGLQFYDDLFDECLKH
GIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFVRFAEVVFKRYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYEEGDDREAIMYQAAHYELVASARAVKIGHEINPDFQIGCMIAM
CPIYPATCNPKDILMAMKAMQKRYYFTDVHVFGKYPEHILKYWERKGISVDFTEQDKEDL
LGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNNYVQASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVEADGMVHDDYRIDYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDDGQGTYERSPKKSFNWYKEVIASNGATVE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttaaagatggatttttatggggtggtgctgtagctgctcatcaacttgaa
ggtggatggcaagaaggtggtaagggtatcagtgttgctgatgtcatgacagctggtcgc
catggagttgcccgtgaaattacaccaggtgttttggaaggtaaatattatccaaaccat
gaggccatagatttttaccatcgttacaaaggagatatagcgctttttgctgaaatggga
tttaagtgcttccgaacatcaattgcttggacacgtattttcccaaagggtgatgaatta
gagcccaatgaagaagggttgcagttttatgatgatctttttgatgagtgcttgaagcat
ggaattgaacctgtaattactttatcccattttgagatgccttatcatttggttacagaa
tatggtgggtggaaaaatcgcaaattgattgatttctttgttcgctttgcagaagtcgta
ttcaaacgttataaagataaagttaaatactggatgaccttcaatgaaatcaacaatcag
gccaattaccaggaagattttgcaccatttacgaactcaggtattgtatacgaggaaggt
gacgaccgagaagctattatgtatcaagcagcacactatgagttagtagcctctgctcga
gcagtaaaaattggccatgaaatcaatccagattttcaaattggttgtatgattgcgatg
tgtcctatttatcctgcaacttgtaatcctaaagacattttaatggccatgaaggctatg
caaaaacgttattactttactgacgtacatgtttttggtaaatatcctgaacacattctc
aagtattgggaacgtaaaggaatctcagttgactttacagagcaagataaagaggattta
cttggaggcacggtagactatattggatttagttactatatgtcttttgctatcgattct
catcgtgagaataatccttatttcgattatcttgaaacagaagatttggttaaaaataat
tatgttcaggcatctgagtgggagtggcagattgacccagagggcttacgttatgcatta
aactggtttactgatcactatcatttgccactattcattgttgaaaatggttttggtgct
atagaccaagttgaagcagatggcatggttcatgatgattatcggattgattacctaggg
gctcatattcgtgaaatgaaaaaagctgtagttgaagatggtgttgatttgatgggatac
actccttggggctgcatagacctagtttcagctggtactggtgagatgagaaaacgttac
ggatttatctatgtggataaagatgatgatggacaagggacttatgaacgctcaccaaag
aaatcatttaattggtataaagaagttattgcatctaatggtgcaacggtggaataa

DBGET integrated database retrieval system