KEGG   Streptococcus salivarius CCHSS3: SALIVB_1902Help
Entry
SALIVB_1902       CDS       T01580                                 

Gene name
recD
Definition
putative exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SALIVB_1902 (recD)
Enzymes [BR:ssr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SALIVB_1902 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1985893..1988397
Genome map
AA seq 834 aa AA seqDB search
MQEFYFSGTIERVIFENTSNFFRILLLEIDETDSDFEDYEIIVTGTMGDVMEGEDYTFWG
QLTNHPKYGEQLQMTRYERSKPSASGLIKYFASDNFKGIGKKTAERIVEIYGEDPIDKIL
EDPSELEQIPNLSKVNREAFVAKLKINYGAEQILSKLSSYGLTPKAASQIFNQYKEESLN
LIEEHPYLLVEEIQGIGFKMADQLAERLGIASDAPERLRAALIHCLLEASMEEGDTYIEA
KALLERTIILLESARPIELDPALVANQLTNLIQEDKVQNVETKIFDNTLYFAEQGIYTHL
TRIMKDQPDVSSEDKILDSLEGVEEELGITYDQVQKDAIIKALQSKVFILTGGPGTGKTT
VINGIIKTYADLHGLDFKKSDLPIILAAPTGRAARRMNELTQLPSATIHRHLGLNSEDDF
KTLEDYLDCDLIIIDEFSMVDTWLANQLFESISDSTQVIIVGDQDQLPSVGPGQVLADLL
QIDNLPKVSLTKIFRQSEDSTIVTLASRMRQGQLPADFTEKKADRSYFEANANHIPQMVP
KIVSAAIKSGIAAQDVQILAPMYRGQAGINNLNTIMQDLLNPQEKANQFAFNDIFFRKND
KILHLVNDTELNVFNGDIGIITDLIPGKYTESKQDEIYMSFDGNEVIYPRNEWNKITLAY
AMSIHKSQGSEFPVVILPITRQSGRMLQRNLIYTAITRAKSKLVMLGEIAAFDYAVRNEG
AKRNTYLIQRFEQTYTQAVDKSVEKIVKNKATDASNQTKTKNNDPSETLENKAFSENINP
SPDLVNTYSQPVDKSVNKPVQTEENYRLTEENWATIDPMIGLSEDDIAAFFNNN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttatttttcaggaactatcgaacgcgtcattttcgaaaacactagtaat
ttttttcgtatcttactcttagagattgacgaaacggacagtgattttgaagactacgaa
atcattgtcacaggaactatgggggatgtcatggagggtgaagactataccttctggggc
caactaaccaatcaccctaaatatggggaacagctacaaatgacccgctacgagcgttca
aaaccttctgccagcggtcttatcaaatattttgccagcgacaatttcaaaggaatcggt
aagaaaacggccgagcgtattgtcgaaatttacggagaagaccctattgacaagattctc
gaggatcctagcgagttagagcagattcccaacctatccaaggtcaatcgagaagccttt
gttgctaagttaaaaatcaattatggagccgagcaaatcctgtccaaactttctagctat
ggcctcacaccaaaggccgcctcacaaattttcaaccaatataaggaagagtcactaaat
cttattgaggaacacccttatctattagtagaggagattcaaggaatcggttttaaaatg
gccgaccaactagctgaacgtcttggaattgctagtgatgcccctgagcgtttacgagca
gccttgattcattgtctactagaagccagtatggaagaaggcgatacctacatagaagcc
aaagccttgcttgaacggaccatcattcttttggaaagtgctcgtccgattgaacttgac
cccgccttggtcgctaaccaattaaccaatcttatccaagaggataaggtgcaaaatgta
gagactaaaatctttgataataccctatattttgcggaacagggcatctatacccaccta
actcgtatcatgaaggaccaacctgatgtcagctctgaagacaaaatattagacagcctt
gaaggggtggaagaggagcttggtattacttatgatcaggttcaaaaagatgccattatc
aaagccctacaaagcaaggtcttcatcctgacaggtggtcccggaacagggaaaaccact
gttattaacggcattattaaaacctatgctgaccttcatggtctagatttcaaaaagtct
gatttgcctattattttagcggcgccaacgggacgggctgctcgtcgaatgaacgaactc
acccaactccctagcgccactatccatagacatttgggcctcaatagcgaggacgatttc
aagaccttagaggactatctcgattgcgacttgattatcatcgatgagttttctatggtt
gatacttggttggctaatcaactttttgaaagtatctctgattcaacccaagtcatcatt
gtgggtgaccaagaccaactgccttccgtaggccctggccaagtcttggctgaccttttg
cagattgataacttgccaaaggtttccctaaccaaaattttcagacaatccgaggactcc
accatcgttaccctggctagtcggatgcgccaaggccaactacccgctgatttcacagag
aaaaaggctgaccgctcttactttgaggccaatgccaaccatattccacagatggttcct
aaaattgtctctgccgctataaagagcgggatcgctgctcaggatgtgcagattctagct
cccatgtatcgaggacaggctggtattaacaatctcaataccattatgcaggacctactt
aatcctcaagaaaaggccaatcagtttgcctttaatgatattttcttccgtaagaacgac
aaaattctccatctggtcaacgataccgaactcaatgtcttcaatggcgacatcggcatc
attaccgatctcatccctggtaaatatactgaaagcaagcaggacgaaatttacatgtcc
tttgatggcaatgaggttatctatcctcgtaacgaatggaataagattactctggcctat
gccatgtcaatccacaaatctcaagggagtgagttcccagtcgttatccttcccatcaca
cgacaaagtggacgtatgctacaacgtaacctcatctacaccgctatcacacgcgccaag
agtaaactagtcatgttaggggaaatcgcagcctttgattatgccgttcgcaacgaagga
gctaaacgaaatacttatctcatccaacgttttgaacaaacttatacacaagctgttgat
aagtctgtcgaaaagattgttaaaaacaaggcaacagacgcctccaatcaaacaaaaacg
aaaaacaacgacccctcagaaacccttgaaaacaaagccttttcggaaaatatcaatcca
tccccagatcttgttaacacttattcacaacctgtggataagtctgttaacaaacctgtg
caaacagaagaaaactatcgtttaactgaagaaaattgggcaactatagatccaatgatt
ggtctcagtgaagacgatattgctgccttttttaacaataactaa

DBGET integrated database retrieval system