KEGG   Streptococcus salivarius CCHSS3: SALIVB_1970Help
Entry
SALIVB_1970       CDS       T01580                                 

Gene name
cap4C
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SALIVB_1970 (cap4C)
   00052 Galactose metabolism
    SALIVB_1970 (cap4C)
   00500 Starch and sucrose metabolism
    SALIVB_1970 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    SALIVB_1970 (cap4C)
Enzymes [BR:ssr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SALIVB_1970 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051532..2052446
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVPHEEVSSYGVIAP
QGEGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILETQEPGAGNEVQLTDAI
DTLNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIDLGHKLEGKP
AKKD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaaaaagttagaaaagctatcatccccgctgcaggactcggaacacgcttt
ttaccagctactaaagccttagccaaagaaatgttgccaatcgttgacaaaccaactatt
caatttatcgttgaagaagccctcaaatcaggtatcgaagatatcttggtggtgactggt
aaatcaaaacgttctatcgaagaccactttgattcaaacttcgagttagaatataacttg
gaacaaaaaggtaagacagacctgttgaaattggttaatgacactactgctattaacctc
cactttatccgccaaagccacccacgtggccttggagatgctgttcttcaagctaaagca
tttgtcgggaatgagccatttgttgttatgcttggtgatgaccttatggatatcactaac
gataaagctgtaccattgactaaacagctcattaacgattatgaggaaacacacgcatca
accattgcagttatgcctgtaccacacgaagaagtttcttcttatggtgtcatcgcccct
caaggcgaaggcgaaaatggacgttatagcgttgaaactttcgttgaaaaaccaaatcca
gaggatgcaccaagtgatcttgctatcatcggacgttaccttctaacacctgaaattttc
ggtattttggaaactcaagaaccaggtgctggaaacgaagtccaattgactgatgctatc
gatacgcttaacaagacacaacgcgtctttgctcgcgaatttactggagaccgttatgat
gtcggtgacaaattcggattcatgaaaacgtctatcgattatgcgcttaaacatcctcaa
attaaagatgacctcaagcaatacctcattgacttgggtcacaaacttgaaggcaaacca
gctaaaaaagactaa

DBGET integrated database retrieval system