KEGG   Streptococcus salivarius CCHSS3: SALIVB_1970Help
Entry
SALIVB_1970       CDS       T01580                                 

Gene name
cap4C
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00040  Pentose and glucuronate interconversions
ssr00052  Galactose metabolism
ssr00500  Starch and sucrose metabolism
ssr00520  Amino sugar and nucleotide sugar metabolism
ssr01100  Metabolic pathways
ssr01130  Biosynthesis of antibiotics
Module
ssr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SALIVB_1970 (cap4C)
   00052 Galactose metabolism
    SALIVB_1970 (cap4C)
   00500 Starch and sucrose metabolism
    SALIVB_1970 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    SALIVB_1970 (cap4C)
Enzymes [BR:ssr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SALIVB_1970 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CCB94219
UniProt: F8LLJ9
Position
2051532..2052446
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVPHEEVSSYGVIAP
QGEGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILETQEPGAGNEVQLTDAI
DTLNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIDLGHKLEGKP
AKKD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaaaaagttagaaaagctatcatccccgctgcaggactcggaacacgcttt
ttaccagctactaaagccttagccaaagaaatgttgccaatcgttgacaaaccaactatt
caatttatcgttgaagaagccctcaaatcaggtatcgaagatatcttggtggtgactggt
aaatcaaaacgttctatcgaagaccactttgattcaaacttcgagttagaatataacttg
gaacaaaaaggtaagacagacctgttgaaattggttaatgacactactgctattaacctc
cactttatccgccaaagccacccacgtggccttggagatgctgttcttcaagctaaagca
tttgtcgggaatgagccatttgttgttatgcttggtgatgaccttatggatatcactaac
gataaagctgtaccattgactaaacagctcattaacgattatgaggaaacacacgcatca
accattgcagttatgcctgtaccacacgaagaagtttcttcttatggtgtcatcgcccct
caaggcgaaggcgaaaatggacgttatagcgttgaaactttcgttgaaaaaccaaatcca
gaggatgcaccaagtgatcttgctatcatcggacgttaccttctaacacctgaaattttc
ggtattttggaaactcaagaaccaggtgctggaaacgaagtccaattgactgatgctatc
gatacgcttaacaagacacaacgcgtctttgctcgcgaatttactggagaccgttatgat
gtcggtgacaaattcggattcatgaaaacgtctatcgattatgcgcttaaacatcctcaa
attaaagatgacctcaagcaatacctcattgacttgggtcacaaacttgaaggcaaacca
gctaaaaaagactaa

DBGET integrated database retrieval system