KEGG   Streptococcus salivarius CCHSS3: SALIVB_2019Help
Entry
SALIVB_2019       CDS       T01580                                 

Gene name
adH2
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SALIVB_2019 (adH2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_2019 (adH2)
   00620 Pyruvate metabolism
    SALIVB_2019 (adH2)
   00650 Butanoate metabolism
    SALIVB_2019 (adH2)
  Lipid metabolism
   00071 Fatty acid degradation
    SALIVB_2019 (adH2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVB_2019 (adH2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVB_2019 (adH2)
   00626 Naphthalene degradation
    SALIVB_2019 (adH2)
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVB_2019 (adH2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SALIVB_2019 (adH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2099653..2102250)
Genome map
AA seq 865 aa AA seqDB search
MTKEIKQTKDIQTVIDELAIKGVEALNEMADFTQEQVDHIVHHAAIAALDKHMYLAKLAV
DETGRGIYEDKAIKNMYASEYIWNSIKNDKTVGVIAEDKEQGLVSIAEPVGVICGVTPTT
NPTSTTIFKALIALKTRNSIVFAFHPSAQKSSAEAARIVRDAAIEAGAPKNCIQWIEEPS
IEATGLLMNHPKIATVLATGGPGMVKAAYSTGKPALGVGAGNVPAYIAADAKVKRAVNDI
ILSKSFDNGMICASEQAAIVDAAIYDEVKAEFEAHQCVIISKKADIAKLEKVVLNEARTA
VNGAIVGHSAIEIAEKAGLKVPAGTKLLLAEIPDATMEHPLALEKLSPVLALIKSDGVED
GFKKAEGMLNLGGLGHTAVIHTENEELQLQYGIRMKACRVLVNSPSAEGGIGNIYNNMIP
SLTLGCGSYGHNSISHNVSSFDLLNVKTLSKRRNNMQWFRVPPKIFFEKDSITYLRHIKA
KRVMLVCDPGMVQFGYAALVKRQLELNRHDPMIEVFSDVEPNPSTNTVYKGLERFVDFQP
DVIIALGGGSAMDAAKAMWMFFEHPDVSFFGAKQKFLDIRKRTYKIPYAEKTTFICIPTT
SGTGSEVTSFAVITDSETHIKYPLADYALTPDIAIVDPALVMSVPASVTADTGMDVLTHA
IESYVSVMASDYTRGLSLQAIKLVFENLEHSYRFGDEESREKMHNASTMAGMAFANAFLG
ISHSLAHKIGPMYNIPHGRTNAILLPHVIRYNGRDPQKHAMFPKYDYFRADKDYADIARF
MGWGTDKQSDAELVELLAQKVYELGIAVGIDMNWKGQGVTKKLLQDTAYTLAEHAYEDQC
TTANPKEPLISELKEIIEIAFDYKG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaaattaaacaaactaaagatattcaaacagtaattgatgaattggcaata
aagggggttgaagccctcaatgaaatggctgactttacacaggagcaagtggatcacatt
gttcaccatgcagcaatcgcagcgcttgataaacacatgtatcttgcaaaattggctgtt
gacgaaacaggtcgtggtatttatgaagacaaagctataaaaaatatgtatgcttctgaa
tatatttggaatagcatcaaaaatgacaagacagtcggtgttattgctgaagataaagag
caaggtttggtctctatcgctgagccggtaggtgttatctgtggggtaactccaacaact
aatccaacatctactactattttcaaagctttgattgcgttgaaaacacgtaactcaatt
gtatttgccttccacccatcagctcaaaaatcatcagcagaagctgcgcgcattgttcgt
gatgctgctattgaagctggtgcacctaagaactgtattcagtggattgaagagccatct
atcgaagcgactggtctcttgatgaaccatcctaagattgccacagtacttgcgactggt
ggacctggtatggttaaagcagcttactcaactggtaaaccagcacttggtgtaggagct
gggaatgtacctgcctatattgcggcagatgctaaagttaaacgtgctgtcaacgatatc
attctttcaaagagttttgacaatggtatgatttgtgcttctgaacaagcagctatcgtt
gatgcagctatttatgacgaagttaaggctgaatttgaagcacatcaatgtgtcatcatt
tctaaaaaagccgacattgctaaattggaaaaagtcgttcttaatgaagcgcgtacagct
gtaaatggtgccattgtaggtcactcagctattgaaatcgctgaaaaagctggtcttaaa
gttcctgcaggtacaaaattgcttttggcagaaattccagatgcaacaatggaacaccca
cttgccttggaaaaattgtctccagtacttgcccttatcaaatctgatggcgttgaagat
ggattcaaaaaagcagaaggtatgctcaatttgggtggtctcggacacacagctgttatc
cacactgaaaatgaagagctccaactccaatatggtattcgcatgaaagcctgccgtgtc
ttggtaaatagcccatcagctgaaggtggtatcggtaatatctacaataacatgatccca
tcattgactcttggttgtggctcatacggacacaactcaatctctcacaatgttagttca
tttgaccttcttaacgtaaaaacattgtcaaagcgtcgcaataatatgcaatggtttcgc
gtcccaccaaaaatcttctttgaaaaagactcaataacatatctgcgtcatatcaaagct
aagcgtgtaatgttggtctgtgatccaggtatggttcagtttggctacgctgccttggtt
aaacgccaattggaactcaaccgtcacgatccaatgattgaagttttctcagatgttgag
cctaacccatctacgaatacggtttataaaggcttggaacgctttgtagacttccaacca
gatgtcattattgcccttggtggtggttctgcaatggatgcggctaaggctatgtggatg
ttctttgaacacccagatgtaagctttttcggtgctaaacaaaaattcttagatattcgt
aaacgtacctataagattccatatgctgaaaagaccacatttatctgtatccctacaact
tcaggtacgggttcagaagtaacgtcatttgcggttatcactgatagtgaaactcatatc
aagtatccattggcagattacgctttgactccggatattgctatcgtcgaccctgctttg
gttatgagtgtacctgccagcgttacggcagatacaggtatggacgttttgactcacgct
attgaatcttatgtatcagtcatggctagcgactatacacgcggactttcacttcaagcg
attaaacttgtttttgaaaatcttgaacattcttaccgttttggtgatgaagaatcacgt
gaaaaaatgcataatgcgtcaacaatggctggtatggcctttgccaatgccttccttggt
attagtcactcattagcacataagattggtccaatgtacaatattccacacggacgtacc
aatgcaattcttctacctcacgttatccgctacaatggtcgtgatcctcaaaaacacgcc
atgttccctaaatatgactacttccgtgcagacaaggattatgctgatattgctcgtttc
atgggatggggtactgacaaacaatcagatgctgaattggttgaacttttggcacaaaaa
gtatatgaattaggtattgccgttggtattgacatgaactggaagggacaaggtgtcact
aagaaacttcttcaagacactgcctatactttggccgaacatgcttatgaagaccaatgt
acaacagctaatccgaaagaaccgcttatttcagaattgaaagaaattatcgaaattgcc
tttgattataaagggtaa

DBGET integrated database retrieval system