KEGG   Streptococcus suis SC84: SSUSC84_0249Help
Entry
SSUSC84_0249      CDS       T00937                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sss  Streptococcus suis SC84
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUSC84_0249 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_0249 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUSC84_0249 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUSC84_0249 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUSC84_0249 (adhP)
   00626 Naphthalene degradation
    SSUSC84_0249 (adhP)
Enzymes [BR:sss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUSC84_0249 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(265108..266133)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcggactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggattgctatctatggtgctggtggacttggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgccgtagacatcaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
cctggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggatatgtagtagct
gtcggacttccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtc
ttcaatgaaatggttgccggtactatccaaggtcgtatggtcttagacttctgccactca
cactaa

DBGET integrated database retrieval system