KEGG   Streptococcus suis SC84: SSUSC84_0387Help
Entry
SSUSC84_0387      CDS       T00937                                 

Definition
beta-galactosidase precursor
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sss  Streptococcus suis SC84
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sss00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432140..433912
Genome map
AA seq 590 aa AA seqDB search
MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALGFNTVETYVPWNMHEP
RKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGLPAWLMKEELRVRSSDS
VYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEEKAYLRAVAGLMRKHGLT
APLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMTAFFNEHQKNWPLMCMEFW
DGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGTNFGFMNGCSARGQIDLPQV
TSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLVKEAKAFSDVSLHDKVSLFAT
LENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEAERFRVVDARDRIQIYADGKFV
ATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHKLTAPTQSKGIGRGAMADLHFIG
HWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDELADTYLDMTGFGKGVVFVNNVNI
GRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYREKIHFSQRPVIKDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattttatattggagaccaattttatttggacggtgaaccctttaagatttta
tcaggcgcgattcattattttcgtgtccatcctgatgattggtaccattctttgtataac
ttaaaggcccttggttttaatacggttgaaacctatgtcccttggaatatgcatgagcct
cgaaagggtgagttttgttacgagggtatattggatattgagcgatttttgaaattggct
caagaattagggctttatgcaattgtacgaccgtccccctatatttgtgctgagtgggaa
tggggtggcctccctgcttggttgatgaaggaagagcttagagtacgttcgagtgattcg
gtgtacttgcagcacttagatgaatattacgtttctcttattcctaaattggccaagctc
caactcgcacagggtggaaatgtacttatgttccaagtggaaaatgagtatggatcttat
ggtgaggagaaggcatatttaagagcggtggctggcttgatgcgtaaacatggtctaact
gctcccttgtttacctcggacggttcttggcgagcaacattacgtgcaggaacactgata
gaggacgatgtatttgtaacaggaaactttggttctaaagctagagagaattttgcaaat
atgacggcattctttaatgaacatcagaagaattggccactcatgtgtatggaattttgg
gatggttggttcaatcgttggggcgatgaaattattcgtagagagccggaggaaatggtt
gattcagttatggaatgtatcgaattgggctccttgaatctgtacatgttccatggtgga
acaaattttggtttcatgaatggttgctctgctcgtggtcaaattgatttgcctcaggta
acttcttatgattatgatgctatattggatgaagctggaaatcctactaagaagttttat
attttgcaacaacgtttgaaagaagtctatcctgaattagagtatgcagaaccgcttgta
aaagaggcaaaagctttttcagatgtgtcgcttcatgataaggtgagtctgtttgctact
ctagaaaatgtaagcgattgcgtaaaagggttttatcctaagaatatggaagaacttgat
cagtcaacaggttatattttatatagaacagagttggagcgggataagacagaagcagaa
cgtttccgagtggttgatgcgcgtgaccgtatccaaatttatgcagatggaaaattcgtt
gcaactcagtatcagactgagattggtgacgatgttgaattggattttaaagatgacaag
ctaacattagatattttggtagaaaatatgggacgtgtcaattatgggcacaaactaacg
gctcctacccagtctaaagggattggtcgaggtgcgatggctgatttacattttattggt
cattgggaaacctatcctttgcatcttgagtcagttgaggacctggattttagtaagggc
tgggaggaaggtcaagctgctttctatcgttatcagtttgaactggatgaacttgcggat
acttacttagacatgacaggttttggtaagggagttgttttcgttaataatgtaaatatt
ggacgtttttgggaaaaaggaccaatcctctatctctatattccaaaaggatacttaaag
aaaggagcgaatgaaatagttgtcttcgagacagaaggaaaatatagagagaagattcat
ttttcacaaagacccgttataaaagacttgtag

DBGET integrated database retrieval system