KEGG   Streptococcus suis SC84: SSUSC84_0641Help
Entry
SSUSC84_0641      CDS       T00937                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sss  Streptococcus suis SC84
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sss00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700348..701862
Genome map
AA seq 504 aa AA seqDB search
MSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGWVEHNANEIWNSVQSV
IAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQSRQTAHIADQLKADG
HADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGTIDTWLVWKLTDGKCH
VTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVYGTTAPFHFYGAEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQNNLLTTIGYGIGGKVY
YALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYVVPAFTGLGAPYWNSD
ARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDISVLKVDGGAAMNSLLM
QFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELNAVGQSFQPTMNEARK
EQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaaatatatcatggccattgaccaaggaactacaagttcacgtgccatt
atcttcaataaaaaaggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttc
cctaaaccaggttgggttgaacacaacgccaatgaaatttggaattctgttcagtctgtg
attgcagggtcctttatcgaaagcggtgttcgtcctgatcagattgaaggaattggtatt
accaaccagcgtgaaacaaccgttgtctgggataaggaaacaggtcttccaatctacaat
gccgttgtctggcaatctcgtcaaacagctcatattgctgaccagctgaaggcggatggt
catgcagatatgattcatcaaaagacaggtctagtagtcgacgcctacttctcagcaacc
aaagttcgttggattttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgag
attctctttggaaccattgatacttggttggtttggaaattgactgatgggaaatgccat
gtgacggattattcaaacgcagctcgtaccatgctctacaacattgaagagttgaaatgg
gatgatgaaattttatctcttctcaatattccaaaagccatgctgccagaagttcgttca
aactctgaagtttacggcacaacagctccattccatttctatggcgcagaagtgccaatc
tctggcatggcaggtgaccaacaggctgccttatttggacaattagcatttgagccaggt
atggtgaaaaatacttacggaaccggttccttcatcgtgatgaatacaggtgaagagatg
cagttgtcacagaacaaccttctcacaacaattggctatggtatcggtggcaaagtctat
tatgcgcttgaaggatctatctttatcgctggttcggcggttcaatggctccgtgacagc
atgcgaatggtgactacatcacctgagtcagaagagcttgctcgtaagtctaccagcaat
gatgaagtctatgttgttccagcctttacaggacttggtgctccgtattggaactcagat
gcgcgtggctcagtctttggtctcactcgtggtacgactaaagaagacttcgtcaaagca
actcttcaatccattgcctaccaagttcgagatgttattgacaccatgcaattggataca
ggtattgatatttctgtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatg
caattccaagcagatattttgggtattgaaatcgcacgcgctcaaaaccttgaaactaca
gctcttggagcagcattcttagcaggtttagcagttggtttctggaaagatttggatgaa
ttgaaagaactcaacgctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaa
gaacaactttacaagggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtg
gatgaagagcaataa

DBGET integrated database retrieval system