KEGG   Streptococcus suis SC84: SSUSC84_1036Help
Entry
SSUSC84_1036      CDS       T00937                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sss  Streptococcus suis SC84
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sss00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sss00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1100121..1101845)
Genome map
AA seq 574 aa AA seqDB search
MPRLVDLRKKPYCLNDEQITWVENTLAHLTDEEKIGQLFVNLFFFGGDAFSGNNLSNQEL
MNRYHIGGARYMNGSPEQVQGLINELQSYSKVPLLVAANCDSGGDGAVKGGTYISSGAQS
EASRDPRIPYLAGLVSAREETALGVNVNFDPCVDIVQNWRNTIVNTRAYGTNADDVITYT
SAYLEGLTAERDVIQCIKHFPGDGKEERDQHLVLGVNELSPEEWDKSFGRVYRHHIEAGV
EMIMAGHIALPYYQQRLNPSLTDEDILPATLAPELIQDLLKEKLEFNGLVITDASHMLGM
TAAMRREDYVPAAIAAGCDMFLFFNNLEEDFEFMLNGYRKGVITDERLHDALRRILGLKA
KLNLHIKQAEGTLLKSADELAIIGCEEHLAWQREAADKAITLLKDTQKNLPISPETHRRI
RLYYLEGEKEGIMAASTEVVDNLKAALEARGYEVTVNDGTTRIKGKTLQYREEVDLALTV
ANVIGYGAQNNYRIQWKTAMSNEVPWYVHEVPTIFISLNYTTHLHDVTMVKTAINAYHHN
KNTIESLLDKLEGKDAFFGVPNENVWANKWQAKL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcctagattggttgatttgcggaagaaaccctattgtttgaatgatgagcagattacc
tgggtagaaaataccttggctcatctgactgatgaagaaaaaatcggtcaattgtttgtt
aatctattcttcttcggaggagacgcttttagcggaaataatctgagtaatcaggaattg
atgaatcgataccacataggtggtgcccgttatatgaatggcagtccagaacaggtacaa
ggactgattaacgagctgcaaagctattcaaaagtacctctcttggttgcagcgaactgt
gactcaggtggagatggagctgtgaaaggaggaacctatatttcctcaggtgctcaatcg
gaagccagtcgggatcctcgtattccctacctagcaggtctcgtatctgcgcgtgaggag
actgcattaggtgtaaatgtcaattttgatccttgcgtggacattgttcagaactggcgc
aatactatcgtcaataccagagcctacggtacaaatgcggatgatgttattacctatacc
agtgcctatttagaaggattgactgctgaaagagatgttattcaatgtatcaagcatttc
ccaggagatggtaaagaagaacgtgatcagcacctagtcctaggcgtcaatgagctctct
ccagaagaatgggacaagagctttggtcgtgtctatcgtcatcatattgaagctggtgtt
gagatgattatggcgggacatatagccttgccatattaccaacaacgactcaatccaagt
ttgacggacgaagatattttgcctgcaacgctggctcctgaattgatccaagatttattg
aaagaaaaactggaattcaatggcttggtcataacagatgccagccacatgttggggatg
acagcagccatgcgtcgtgaagactacgtacctgcagccattgctgcgggttgcgatatg
ttcttattcttcaataacttagaagaagattttgaatttatgctcaatggctaccgcaag
ggagtgattactgacgaacgccttcatgatgctctccgtcgcattttaggtctgaaagcc
aaactcaatctgcatatcaagcaagcggaaggaaccttactaaaatcagctgatgaattg
gctattatcggctgtgaagaacacttggcttggcaacgtgaggcggcagacaaggcaatt
acgctgttgaaagatacacagaaaaatcttccaatcagtccagaaacccatcgcagaatc
cgattgtattacctagaaggtgaaaaagaagggattatggcggcaagtacagaagtggtt
gataaccttaaagctgccttggaagcgcgtggctatgaagtgaccgtcaatgatggtacg
actcggatcaaaggaaaaacgctgcaataccgagaagaagttgatttagccttgactgtt
gccaatgtcattggatatggagcgcagaataattaccgcatccagtggaaaacggccatg
tcaaatgaagttccttggtatgtacatgaagttccaaccattttcatttcactaaactat
acaactcaccttcacgatgttaccatggtcaaaactgctatcaatgcctaccatcacaat
aaaaatactatcgaatccttacttgataaattagaaggaaaagacgcattctttggtgtg
ccaaatgagaatgtttgggccaataaatggcaggcaaaactataa

DBGET integrated database retrieval system