KEGG   Streptococcus suis SC84: SSUSC84_1037Help
Entry
SSUSC84_1037      CDS       T00937                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sss  Streptococcus suis SC84
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUSC84_1037
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SSUSC84_1037
Enzymes [BR:sss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSUSC84_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1101856..1103646)
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYSLDEEAISWIEETIAQMTLDEKIGHLFVNMGSQRTEDYLTGVLNDYKI
AAVRYNPGPAADIWEQNYILQTKSKIPLLIAANTESGGNGAVTDGTKIGDEIKIAATTDP
RYAYEMGKVAGLEAAAVGCNASFAPIMDLSRNWRNPIIANRTWGANVDQVIELSKEYMRG
IMEHGIVPFAKHFPGDGIDERDHHLSFASNPMTKSEWMETFGRIYGEMADAGLPGIMAGH
IHLPNVEKEMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMIGMTASMPRR
ELLPTAIEAGCDLFLFFNDPEEDLQWMKEGLENGLLSEERLHDALRRTLGLKAKLGLHLF
EGRRQEIMLPKEEALALIGRDEAKQLAKEVADKAITLVKAKQEGIFPVNPERYKRILLVE
VDGYKGGFGAMINAGKKRAADTLKELLEARGHQVSIWENTEARIAKLPEEERPAAIANVY
ASKRPIAEITDNYDLIINLVDVNSGGTTQRIIWPAAKGTPDQPFYVHEIPTIIVSVQHPF
ALADMPQVATYINAYDGLPVTLEALVAKLAGESAFTGVSPVDAYCGLVDTQIWRGK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttacggaagaaaccttacagccttgatgaagaggctatttct
tggattgaagaaaccattgctcagatgaccttggatgaaaaaatcggtcacctctttgtc
aacatggggagccagcggacagaagactatctgactggagtattaaatgattataagatt
gctgctgttcgttacaatcctggacctgctgcagatatttgggagcaaaactatattttg
cagaccaagtctaagattcccctcttgattgcagccaataccgaatctggtggaaatggc
gctgttacggatggaacgaaaattggggatgaaatcaagattgctgcgacaaccgatccc
cgctatgcttatgaaatggggaaagttgcaggacttgaagcagctgcggtaggctgcaat
gcctcctttgcaccgattatggacctaagccgtaattggcgcaatccaatcattgcaaac
cgaacatggggagctaatgtagaccaagtcattgaattgtccaaagaatacatgcgaggc
attatggaacatggcattgtgccgtttgctaagcattttcctggagatggtattgacgaa
cgagatcatcatttgtctttcgcttcgaatcccatgaccaagtctgaatggatggaaaca
tttggacggatttatggtgagatggctgacgcaggtctcccaggtattatggcggggcac
attcatttgccaaatgttgagaaagaaatgcatccagaacgtgaattggatgacatgttg
ccagcttcgctgaataaaaccctcttggatgaattgcttcgtggagagttaggttacaat
ggtgccattgtcacggatgccagtcacatgatcggtatgacagcctctatgccgcgtcgt
gagctattgcctacagctattgaggcaggatgtgatcttttccttttcttcaacgatcca
gaagaagatttgcaatggatgaaagaaggattggaaaatggtctgctttctgaggaacgc
ctccatgatgcccttcgtcgtaccttgggcttgaaagctaaactcggtcttcacttgttt
gaaggtcgtcgtcaggaaatcatgttgccaaaagaagaagcactggctttgattggtaga
gatgaggcgaaacagcttgcaaaagaagtagctgacaaggcgattaccttggtaaaagcc
aaacaagaaggaattttcccagtcaatccagaacgctacaaacgtattttgttggtcgaa
gtagatggctataagggtggttttggtgccatgatcaatgctggcaagaagagagcagcc
gatacgctgaaagaactattagaagctcgaggtcaccaagtatctatctgggaaaatacg
gaggcacggattgccaaattgccagaagaagaaagaccagcagcgattgcaaatgtctat
gcttccaagcgtccaattgcggaaatcacagataactatgatttgattatcaatttagtt
gatgtcaactcaggaggaacaactcagcgaattatttggccagctgccaagggaacacca
gaccagcctttctatgttcacgaaattccaaccattattgtctctgttcagcacccattt
gcacttgcagatatgccacaggttgcaacctatatcaatgcctacgatggcttgcctgtc
acattagaagccttggttgctaaactagcaggagagtcagcctttacaggagtatcgcct
gttgatgcctactgtggcttggtagatacacagatttggcgcggaaaataa

DBGET integrated database retrieval system