KEGG   Streptococcus suis SC84: SSUSC84_1481Help
Entry
SSUSC84_1481      CDS       T00937                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sss  Streptococcus suis SC84
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUSC84_1481 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSUSC84_1481 (atoB)
   00640 Propanoate metabolism
    SSUSC84_1481 (atoB)
   00650 Butanoate metabolism
    SSUSC84_1481 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUSC84_1481 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSUSC84_1481 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUSC84_1481 (atoB)
   00310 Lysine degradation
    SSUSC84_1481 (atoB)
   00380 Tryptophan metabolism
    SSUSC84_1481 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUSC84_1481 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUSC84_1481 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSUSC84_1481 (atoB)
Enzymes [BR:sss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUSC84_1481 (atoB)
Exosome [BR:sss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUSC84_1481 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1553978..1555162
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system