KEGG   Streptococcus suis SC84: SSUSC84_1661Help
Entry
SSUSC84_1661      CDS       T00937                                 

Gene name
pdhB
Definition
pyruvate dehydrogenase E1 component, beta subunit (EC:1.2.4.1)
Orthology
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sss  Streptococcus suis SC84
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUSC84_1661 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_1661 (pdhB)
   00020 Citrate cycle (TCA cycle)
    SSUSC84_1661 (pdhB)
   00620 Pyruvate metabolism
    SSUSC84_1661 (pdhB)
Enzymes [BR:sss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SSUSC84_1661 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739531..1740526)
Genome map
AA seq 331 aa AA seqDB search
MAETKVMALREAINLAQSEEMRKDEKVFLMGEDVGIYGGDFGTSVGMLDEFGPKRVRDTP
ISEAAIAGSAVGAAQTGLRPIVDLTFMDFITIALDAIVNQAAKTNYMFGGGLKTPVTFRV
ASGSGIGSAAQHSQSLEAWLTHIPGIKVVAPGTANDAKGLLKSSILDNNPVIFLEPKALY
GKKEEVNLDPDFYIPLGKGEIKREGTDVTIISYGRMLERALKAAEEVAAEGISVEVVDPR
TLIPLDKELIIESVKKTGKVILVNDAYKTGGFIGEIASIITESEAFDYLDAPIIRIASDD
VPVPYANILENAVLPNVEKIKAAIYKQVNKG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacaaaagtaatggccttgcgtgaagcgattaacttggctcaaagcgaagaa
atgcgtaaggatgaaaaagtattcttgatgggtgaagacgtcggtatctacggcggtgac
tttggtacatctgttggtatgttggacgagtttggtccaaaacgcgttcgcgacacgcct
atctctgaggctgcaatcgctggttctgcggttggtgcagctcaaacaggtcttcgtcca
atcgttgacttgactttcatggacttcatcacaattgcccttgatgcaattgttaaccag
gctgccaaaaccaactacatgtttggtggtggtttgaaaacacctgtaactttccgtgtg
gcttcaggttcaggtatcggttcagcagcacagcactcacagtctcttgaagcttggttg
actcacattccaggtatcaaggtggttgcacctggtactgctaacgatgcaaaaggtctt
ctgaaatcatctatccttgacaacaacccagttatcttcttggagccaaaagctctttac
ggtaaaaaagaagaagtgaacttggatccagatttctacattccacttggtaagggtgaa
atcaaacgtgaaggtactgatgtaaccattatttcatacggtcgtatgttggaacgtgcc
ttgaaagcggctgaagaagtggctgctgaaggtatcagcgtagaagtggttgacccacgt
acccttatcccattggataaagaattgatcatcgaatctgtgaagaaaactggtaaggtt
atcttggttaacgatgcttacaaaacaggtggtttcatcggtgaaatcgcatcaatcatc
acagaaagcgaagcctttgactacttggatgcaccaatcatccgtatcgcttcagacgat
gtaccagttccttacgcaaacattcttgaaaacgcagtattgccaaacgtagagaaaatc
aaagcggcaatctataagcaagtaaacaagggttaa

DBGET integrated database retrieval system