KEGG   Streptococcus suis SC84: SSUSC84_1661Help
Entry
SSUSC84_1661      CDS       T00937                                 

Gene name
pdhB
Definition
pyruvate dehydrogenase E1 component, beta subunit (EC:1.2.4.1)
Orthology
K00162  
pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
Organism
sss  Streptococcus suis SC84
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sss01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sss00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sss00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sss00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739531..1740526)
Genome map
AA seq 331 aa AA seqDB search
MAETKVMALREAINLAQSEEMRKDEKVFLMGEDVGIYGGDFGTSVGMLDEFGPKRVRDTP
ISEAAIAGSAVGAAQTGLRPIVDLTFMDFITIALDAIVNQAAKTNYMFGGGLKTPVTFRV
ASGSGIGSAAQHSQSLEAWLTHIPGIKVVAPGTANDAKGLLKSSILDNNPVIFLEPKALY
GKKEEVNLDPDFYIPLGKGEIKREGTDVTIISYGRMLERALKAAEEVAAEGISVEVVDPR
TLIPLDKELIIESVKKTGKVILVNDAYKTGGFIGEIASIITESEAFDYLDAPIIRIASDD
VPVPYANILENAVLPNVEKIKAAIYKQVNKG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacaaaagtaatggccttgcgtgaagcgattaacttggctcaaagcgaagaa
atgcgtaaggatgaaaaagtattcttgatgggtgaagacgtcggtatctacggcggtgac
tttggtacatctgttggtatgttggacgagtttggtccaaaacgcgttcgcgacacgcct
atctctgaggctgcaatcgctggttctgcggttggtgcagctcaaacaggtcttcgtcca
atcgttgacttgactttcatggacttcatcacaattgcccttgatgcaattgttaaccag
gctgccaaaaccaactacatgtttggtggtggtttgaaaacacctgtaactttccgtgtg
gcttcaggttcaggtatcggttcagcagcacagcactcacagtctcttgaagcttggttg
actcacattccaggtatcaaggtggttgcacctggtactgctaacgatgcaaaaggtctt
ctgaaatcatctatccttgacaacaacccagttatcttcttggagccaaaagctctttac
ggtaaaaaagaagaagtgaacttggatccagatttctacattccacttggtaagggtgaa
atcaaacgtgaaggtactgatgtaaccattatttcatacggtcgtatgttggaacgtgcc
ttgaaagcggctgaagaagtggctgctgaaggtatcagcgtagaagtggttgacccacgt
acccttatcccattggataaagaattgatcatcgaatctgtgaagaaaactggtaaggtt
atcttggttaacgatgcttacaaaacaggtggtttcatcggtgaaatcgcatcaatcatc
acagaaagcgaagcctttgactacttggatgcaccaatcatccgtatcgcttcagacgat
gtaccagttccttacgcaaacattcttgaaaacgcagtattgccaaacgtagagaaaatc
aaagcggcaatctataagcaagtaaacaagggttaa

DBGET integrated database retrieval system