KEGG   Streptococcus suis SC84: SSUSC84_1850Help
Entry
SSUSC84_1850      CDS       T00937                                 

Gene name
hasC
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sss  Streptococcus suis SC84
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSUSC84_1850 (hasC)
   00052 Galactose metabolism
    SSUSC84_1850 (hasC)
   00500 Starch and sucrose metabolism
    SSUSC84_1850 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SSUSC84_1850 (hasC)
Enzymes [BR:sss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSUSC84_1850 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942373..1943272
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatccctgcagcaggtttgggaacacgtttcttgcct
gccactaaggctcttgccaaagaaatgttgccgattgttgataaaccaactattcaattt
atcgttgaagaagctctacgatctggtatcgaagatattttggtggtcactggtaaatca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacaggcattcgactacacttc
attcgtcaaagccatccacgtggacttggtgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggacatcacagatacaaaa
gctgtcccattgactaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcccgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgctatcgataca
ctcaataaaacacaacgcgtgtttgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system