KEGG   Streptococcus suis ST3: SSUST3_0284Help
Entry
SSUST3_0284       CDS       T01470                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sst  Streptococcus suis ST3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSUST3_0284
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST3_0284
   00620 Pyruvate metabolism
    SSUST3_0284
   00650 Butanoate metabolism
    SSUST3_0284
  Lipid metabolism
   00071 Fatty acid degradation
    SSUST3_0284
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUST3_0284
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUST3_0284
   00626 Naphthalene degradation
    SSUST3_0284
Enzymes [BR:sst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUST3_0284
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSUST3_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275505..278156
Genome map
AA seq 883 aa AA seqDB search
MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYIVAKASVAALDKHGEL
AMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDEVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARVVYEAAVAAGAPENCIQW
ITKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVTEFKSYKTYFVNKKEKALLEEYCFGV
KANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILAAEVAEIGEKEPLTREKLSPV
IAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELAKEFGTIVRAIRVIWNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIKKVGRRRNNMQWFKVPSKTYFER
DSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLDLRRNKVVYQIFSDVEPDPDITTV
YKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPE
LGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAH
VTADTGMDVLTHATEAYVSTVANDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YKADEKYQDIARLLGLPCSTPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSR
ELVLLAYEDQCTPANPRLAMVDHMQEIIEDAYYGYKERPGRIK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaagtagtatcaccagaagaaaagttggtagaagcgcgcaagcacgtc
gatgagcttgttcaaaaaggtttggttgctcttgatgagttccgtaaacttggtcaagaa
gaagtagactatattgtagcgaaagcttcggttgcagcccttgataaacatggcgaattg
gcaatgcacgcctttgaagaaactaagcgtggtgtattcgaagacaaggctactaagaac
ttgtttgcttgtgagcacgttgtcaataacatgcgtcacacgaaaactgttggtgttatt
gaagaagatgaagtgacaggtttgactttgattgctgagccggtcggtgttgtttgtggt
atcacaccaacaacaaacccaacttctacagcaatctttaaatcattgattgccttgaag
acacgtaatccgattgtctttgccttccacccatctgcacaagaatcttctgctcatgca
gctcgtgttgtctatgaagcagctgtggcagctggtgctcctgaaaactgtatccagtgg
attacaaaaccatctatggaagcaacatctgagttgatgaaacatgatggtattgcaaca
atccttgcaactggtggtaacgcaatggtgcgcgcagcttactcttgtggtaaacctgcc
cttggtgtaggtgcaggtaacgttccagcctatgttgaaaaatcagcaaatattcgtcag
gcagcacatgacatcgttatgtctaagtcatttgacaacggtatggtctgtgcgtcagaa
caagcagttatcattgataaagaagtttacgatgagtttgtaacagagttcaaatcttac
aaaacttacttcgttaataagaaagaaaaagctcttcttgaagaatactgcttcggtgtg
aaagctaacagcaaaaactgtgctgaaggtaaattgaacgcagacatcgttggtcgccca
gctgcatggatcgctgagcaggccggcttctcagtaccagaaggtacaaacatcttggca
gctgaggttgctgaaatcggtgaaaaagaaccattgactcgtgagaaattgtcacctgtt
attgccgtcttgaaagttgaaggtcgtgcagaaggtcttgaagcagctcgccaaatggtt
gaattccacggtctcggtcactctgcagctattcatacggaagacgcagaattggcgaaa
gagtttggtacaatcgtacgtgctatccgtgttatttggaactctccatctactttcggt
ggtatcggtgatgtttacaacgcattcttgccatcattgacacttggttgtggttcttac
ggacgcaactcaatcagtgataacgtaagtgctatgaacttgctcaacatcaagaaagta
ggaagacgtagaaataatatgcaatggtttaaagttccttctaaaacatacttcgaacgt
gactctatccaatatctccaaaaatgccgtgacgttgaacgtgtcatgatcgttacagac
cgtgccatggtagaacttggattcctagatcgtatcatcgaacaattggaccttcgtcgt
aataaagttgtttatcaaatcttctcagacgttgagccagatccagacatcacaacggtt
tataaaggtacagaattgatgcgtaccttcaaaccagatacaatcatcgcactcggtggt
ggttcaccaatggatgctgccaaagttatgtggctcttctacgaacaaccaacagttgat
ttccatgacctagttcaaaaattcatggatatccgtaaacgtgccttcaagttcccagaa
cttggtaagaaatctaagtttatcgcgattccaactacatcaggtacaggttcagaagta
acaccgtttgccgtaatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgttgacccagcactcgtattgacagtacctgcacac
gttacagcggatactggtatggacgtattgactcacgctacagaagcatacgtttcaaca
gtagccaacgactttacagatggtttagcacttcaagctatcaaactagtatttgaaaac
cttgaaagctcagtgaagaatgctgactttgtatcacgtgagaaaatgcacaacgcatca
actatggcaggtatggccttcgccaacgcattcctaggtatttctcactcaatggctcat
aagattggtggacgtttccataccgttcacggtcgtacaaacgctatcttgcttccgtac
gttatccgctacaacggtactcgtccagctaagacagctacatggcctaagtacaactac
tataaagcagatgaaaaataccaagacatcgctcgtcttctaggtttgccatgttcaaca
ccagaagaagctgttgcagcatacgcacaagcagtttatgacctcggtgaacgcatcggt
atccaaatgaacttgaaagcacaaggtatcgacgagaaagaactcaaagaacactctcgc
gaattggttcttcttgcctacgaagatcaatgtaccccagctaacccacgtctagcaatg
gttgaccacatgcaagaaatcatcgaagatgcctactacggttacaaagaacgtccaggt
cgcatcaagtaa

DBGET integrated database retrieval system