KEGG   Streptococcus suis ST3: SSUST3_0285Help
Entry
SSUST3_0285       CDS       T01470                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sst  Streptococcus suis ST3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSUST3_0285
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUST3_0285
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSUST3_0285
Enzymes [BR:sst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSUST3_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278571..280055
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPISIPAVDLDFSVLKDASYQEVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTPAIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMTTAAKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKRMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFSTGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFDNDAAKTAELMEALNTAGQYDIQ
GADADILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVALPPAVDGLETAPVRHNTVVA
AADMQAEVERYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcggctagtcaggcg
atattgcagggcttggcgaccgacggtggtttgtttacaccgatttctattccagcagtt
gacttggacttttctgttctcaaagacgcttcttatcaagaagttgccaagttgattttg
tcggctttcttggacgattttacggcagatgagttggactactgtatcaacaatgcctac
gatagcaagtttgacacaccagctattgccccagtggttaagctaaaaggtcagtacaat
ttggaactcttccgaggttcaaccattgcctttaaggatatggctctgtccatcctccct
tacttgatgacgactgcggcgaaaaagcatggtttggaaaatgagattgtcattttgacc
gcgacttcaggcgatacaggtaaggcagctatggctggttttgcagacgttcctggcacg
caaatcattgtcttctacccacgtgacggggtatctaaggtccaagaattgcagatgact
acgcagacaggggctaatacgcacgtggtggccattgacggtaactttgacgacgcccag
acaaatgtcaaacgtatgttcaacgatgaggctctccgtgccaagttggcagcgaagaaa
cttcagttttcatctgccaattctatgaacatcggccgcttggtgccacagattgtttac
tatgtctatgcctacgctcagctggttaagactggcgagattgcggcgggcgacaaggtc
aacttcaccgttccaacaggaaactttggaaacatcttggcggcttattacgccaaacaa
atcggtctgccagttggcaagctcatctgtgcttccaacgacaacaatgtcctaaccgac
ttcttctcgactggcgtttacgacaagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcttctaacttggagcgcttgattttccatctctttgacaatgac
gctgcaaaaacagcggagctgatggaagccttgaacacagctggtcagtatgatattcaa
ggggctgacgcggatatcctctctctctttgctgccgcctttgcgacggaagaagaaacg
gctgcggaaatcaagcgagtctatgacgagtcagactacattgaagacccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgactgtg
attgcttctacagcaagtccttacaagttcccagtagttgcggttgaggctgtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagct
ttgccaccagctgtggacggcttggaaacggcacctgtccgccacaatactgttgttgcg
gcagccgatatgcaggctgaagtagagcgttatttgggtgtttaa

DBGET integrated database retrieval system