KEGG   Streptococcus suis ST3: SSUST3_0417Help
Entry
SSUST3_0417       CDS       T01470                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sst  Streptococcus suis ST3
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sst00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412271..412897
Genome map
AA seq 208 aa AA seqDB search
MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGVDYFFRSRE
EFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEVPLAAERVK
RIIEAEHFRVDRVIGRYDEMIREQIAER
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgaggcttactcattgtcttttctggcccatctggtgttggaaaaggaaca
gttcgaaaggaaatttttgaaagctctgataataaatttgaatattctgtatccatgacg
acacgtccacagagaccgggagaagttgatggagttgactatttcttccgtagtcgtgag
gaatttgaagatttgattcgccagggtcaaatgttggaatatgcagagtacgttggaaat
tactatggaacacctctgacctatgtcaatgaaactcttgataagggaattgatgtcttt
ttagaaattgaagtacagggtgccctccaagtgaagaaaaaggttccagatggggtgttc
attttcttgacaccacctgacttggaggagttgcaagatcgcttgattggtcgcggaacg
gatagtgaggaagttattgctcaacgtatcgaacgtgccaaggaagagatcgccttgatg
cgtgagtatgattatgcagttgtgaacgatgaagtcccgttggctgctgagcgtgtcaag
cgtattatcgaagcagaacatttccgtgtagaccgagtgattggtcgctacgatgaaatg
attcgtgaacagatagcagaacgataa

DBGET integrated database retrieval system