KEGG   Streptococcus suis ST3: SSUST3_0477Help
Entry
SSUST3_0477       CDS       T01470                                 

Definition
galactose mutarotase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sst  Streptococcus suis ST3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST3_0477
   00052 Galactose metabolism
    SSUST3_0477
Enzymes [BR:sst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSUST3_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
465410..466411
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFGEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIIPVAGRISGAQAEIKGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYRLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDLAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKMTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttggtgaaaaagcaaaactgtattgcttggaaaacaagaat
ggtatgcaggtcactctgacagattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaacaattatcccagtagcggggcgtatttcaggagcc
caagctgagataaagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttatcgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgcccacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagatttggcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgatcacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatatat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttaccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaatgacctatcgttttacttggtaa

DBGET integrated database retrieval system