KEGG   Streptococcus suis ST3: SSUST3_0555Help
Entry
SSUST3_0555       CDS       T01470                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
sst  Streptococcus suis ST3
Brite
Transcription machinery [BR:sst03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     SSUST3_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
549268..549705
Genome map
AA seq 145 aa AA seqDB search
MQKSGAGPADSQDIAQDVLVKLLESDIVLPFEKLRAWLYRSAVRAYIDKYRRDKRYHEIL
QKEFFRREDLLVYDQEGYEELYQAVADLPEKYQQVIDLYYFQDMSVKEVAHILGTGQSWV
KIILYRGRKQLRKILEERGYDYEDF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaatcaggagccggcccagctgacagtcaggatattgcccaagatgttctagtc
aaattgcttgaatctgatattgtccttcctttcgaaaaactaagagcttggctttaccga
tctgcagttcgggcttacattgacaaatacaggcgagacaagcgctaccatgaaatttta
caaaaggagttttttagaagagaagaccttttggtctatgaccaagaaggttatgaggaa
ctctatcaagcagttgcagacctgccagaaaaataccagcaagtgattgacctctattat
tttcaagatatgagtgtcaaagaagttgcccatatcttagggactggtcaaagttgggtg
aaaattatcctttaccgcggacgcaagcagttgaggaaaatactagaagagagaggatat
gactatgaagacttttga

DBGET integrated database retrieval system