KEGG   Streptococcus suis ST3: SSUST3_0555Help
Entry
SSUST3_0555       CDS       T01470                                 

Definition
ECF subfamily RNA polymerase sigma-24 subunit
Orthology
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
sst  Streptococcus suis ST3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549268..549705
Genome map
AA seq 145 aa AA seqDB search
MQKSGAGPADSQDIAQDVLVKLLESDIVLPFEKLRAWLYRSAVRAYIDKYRRDKRYHEIL
QKEFFRREDLLVYDQEGYEELYQAVADLPEKYQQVIDLYYFQDMSVKEVAHILGTGQSWV
KIILYRGRKQLRKILEERGYDYEDF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaatcaggagccggcccagctgacagtcaggatattgcccaagatgttctagtc
aaattgcttgaatctgatattgtccttcctttcgaaaaactaagagcttggctttaccga
tctgcagttcgggcttacattgacaaatacaggcgagacaagcgctaccatgaaatttta
caaaaggagttttttagaagagaagaccttttggtctatgaccaagaaggttatgaggaa
ctctatcaagcagttgcagacctgccagaaaaataccagcaagtgattgacctctattat
tttcaagatatgagtgtcaaagaagttgcccatatcttagggactggtcaaagttgggtg
aaaattatcctttaccgcggacgcaagcagttgaggaaaatactagaagagagaggatat
gactatgaagacttttga

DBGET integrated database retrieval system