KEGG   Streptococcus suis ST3: SSUST3_0558Help
Entry
SSUST3_0558       CDS       T01470                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sst  Streptococcus suis ST3
Pathway
sst00010  Glycolysis / Gluconeogenesis
sst00051  Fructose and mannose metabolism
sst00562  Inositol phosphate metabolism
sst01100  Metabolic pathways
sst01110  Biosynthesis of secondary metabolites
sst01120  Microbial metabolism in diverse environments
sst01130  Biosynthesis of antibiotics
sst01200  Carbon metabolism
sst01230  Biosynthesis of amino acids
Module
sst_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sst_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST3_0558 (tpiA)
   00051 Fructose and mannose metabolism
    SSUST3_0558 (tpiA)
   00562 Inositol phosphate metabolism
    SSUST3_0558 (tpiA)
Enzymes [BR:sst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUST3_0558 (tpiA)
Exosome [BR:sst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUST3_0558 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUST3_0558 (tpiA)
  Exosomal proteins of melanoma cells
   SSUST3_0558 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB81021
Position
552384..553136
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaataaaaaccctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgcacaagtttctgcagctttgaaagacttgactgctgaacaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtacaggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgtccgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system