KEGG   Streptococcus suis ST3: SSUST3_0631Help
Entry
SSUST3_0631       CDS       T01470                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sst  Streptococcus suis ST3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSUST3_0631 (recR)
DNA repair and recombination proteins [BR:sst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SSUST3_0631 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631846..632442
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSIC
GNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMNGIGPD
DINLKTLLTRLMDNEVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccctacacctattgccaagttaattgatagctattctaaattgccaggtatc
ggtataaaaacggctacccgtttagctttttatactattggcatggaggatgatgtcgtt
aatgagtttgcaaaaaatttattggcagccaagcgagacctatcttattgctctatttgt
ggtaatttgacagatcaggacccctgtgctatttgccaggactcaacgcgagaccaatct
actattttgattgtagaggatagtcgagatgttacagccttggaaaatattcaagaatac
cacggtctttatcatgtcttgcatggcttgatttctcccatgaatggtattggaccagat
gatattaatttgaaaaccctcctcactcgcctgatggacaatgaggttacagaagttatt
gtggcgaccaatgcaacagcagatggagaagctacatctatgtatatctcacgtgtcctc
aaacctgcgggaatcaaagtaacccgactagctcgtggcttagcggtaggcagtgatatt
gaatatgcagatgaagtgaccctgttgagggctattgaaaaccgcacagagctatag

DBGET integrated database retrieval system