KEGG   Streptococcus suis ST3: SSUST3_0686Help
Entry
SSUST3_0686       CDS       T01470                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sst  Streptococcus suis ST3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SSUST3_0686 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUST3_0686 (rmlC)
Enzymes [BR:sst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SSUST3_0686 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689946..690539
Genome map
AA seq 197 aa AA seqDB search
MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIQWENLEEAEVSEAD
KNHPLLKDVKPLRKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaactttttcggtaaaacactagcagctcgcccagttgaagctattccagga
atgttagaattcgacattcctgttcatggcgacaaccgtggctggttcaaggagaacttc
caaaaggaaaaaatgttgcctctcggctttcctgaaagcttctttgcagaaggaaaattg
cagaataatgtttccttctctcgtaaaaacgttcttcgtggtcttcacgcagagccttgg
gataaatacatttcagtagcagacggcggtaaggttttgggaacttgggtcgatctacgt
gaaggcgaaaccttcggtaatacctaccaaaccgttatcgatgcttcaaaaggtatcttc
gttccgcgcggagtagccaatggtttccaagtcttgtcagatttcgtggcttacagctac
ttggtcaacgactactgggctttggagcttaagcctaagtatgccttcgtcaactacgct
gacccgagccttgacatccagtgggaaaacctagaagaagcagaagtttcagaagcagat
aaaaatcacccactcctcaaagatgtgaagcctttgagaaaagaggacctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system