KEGG   Streptococcus suis ST3: SSUST3_0785Help
Entry
SSUST3_0785       CDS       T01470                                 

Definition
LPXTG-motif cell wall anchor domain-containing protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sst  Streptococcus suis ST3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUST3_0785
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSUST3_0785
Enzymes [BR:sst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSUST3_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791364..795623
Genome map
AA seq 1419 aa AA seqDB search
MKKETSKFTKKVILGQLLICTSFLVWAGQTVAAEEVSQGEPVAINNETPPAIEAKPLVEA
TPSTETEPSTPEEKQEEPQVADKNVVEGKKPVTNSQHQMVSELSTVPSVSIKNPDAATDG
SAYGSSDDANSNTKIIAGKETGESDNGYSKWDHVYVQYDFEKEVPVHTVKIHRNTYDNAV
STFKDVKVELSTSVDFSPETTEVIFKQADVEETIANKGQPQVIQLPAPINARYIRIWGRG
HYIQNTNSSWKGYSNGVLFNEIEVLAQVEADAGTNEEPQTELVNLAKLKKPYFYGKAPTN
PEAINDGKFDENYTTQESIGDKAYLQYEFRNVYTIEEIKVQLAPGEYRNFRIDLDDDYND
GNNYNTIYKNENFTIDKEQIITIKTPKNSKARYVRFRGTRVDDTPLRYSEIQIMGRGKSY
DESAPEYVPPKSEYDTLVWSDEFNGDKIDESKWQIIDGMWNHAAIYNRKAVSIKKDGDKS
YLSIRSTNHKDKKALVEAVGHDRYDDKELPDKVTWSSGRLESKDKYSFQFGRMAVRAKVN
DSKGIWPAIWMLAQDETGHDEIDVLEYLGQNPWDAWTTNHFGILAKNKKSDGSAYKNYEA
WSQEFHVYEVEWTPDVIKWYIDGKFVFQTDRGKDRDGMHTRPMFPILETQVGDGWVGDVD
YKRNMTKQDSEYLVDWVRIYQKADQSKVHFDNLDDAKPNDYVIKPQQKLGHLVTVSNGKA
AHENKNNFYYGGQPRYETSRLYADGDGENALVYKIANPEALHLTTYYKTLEDYSVYNKEA
GANEGKSVRKHLINAKDGEIDFTVYSSVDGKSWNKENVTVVDNFVEATPAYARTTFDIRN
IRKGTKFVKIVFPTVKGISYKLEDGTEKGLQASDVQLAKVTFVATHPEAEPEKPIVDQEK
LALSKVFSLDAGRKYFSVNQIKEIIDLISSYGYTDMNLLLGNDGLRFLLDDMNLTVGDKV
YDSEAVRKAIINGNKHYYDDPNGTTLSQSEMDDILAYAKEKNISIIPTINSPGHMDAIVE
AMEELGIKSPKFSYNGKTSARTVDLKNDQAVAFTKALIDKYASYFAGKSKIFNIGLDEYA
NDATNASGWHILQTQGDYGKFIQYANDLAAIVKKHGLEPMAFNDGIYYNHDTSSGTFDKD
IIASFWTGGWGGYDVASSKFLHEKGHKILNTNDAWYYVIGREAEGLGWYNLDQGLRGTKS
TRFDQVPKSENTKVPIIGSMVAVWADDPSKPYSYDSIKKLLHSFTENNSDYFWAEYRDLR
EEVGKIPTDLNSYTPESVATLKEVLNKIDWKLSRNNQAFVDGYLAEVKAAREALVPVTAK
GDSVKAEPLPEGKLPLITAKGKSVQAEPRPAFKGYLTSNYGPSVTPLSLVSKPSSEQSRS
QQAAYQKKELPNTGAVDGLGFSLLGMLGLAFASRRRKEE
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaacaagtaagtttacgaaaaaagtcatccttggtcagcttctcatctgt
accagttttttggtatgggcagggcagaccgttgcagcagaggaagtatctcagggggaa
ccagtagcaatcaacaatgaaactccacctgctattgaagcaaaaccacttgtggaagct
actccatcaactgaaacagaaccttcaactccagaagaaaaacaggaggaaccacaagta
gctgataaaaatgtggtagaagggaaaaagcccgtaactaacagccagcatcagatggtt
tcggaattatcaacggtcccttctgtttctataaaaaatccagatgcagctaccgatggg
agtgcttacggtagtagcgacgatgccaatagcaataccaaaatcattgctggtaaagaa
actggcgaatcagataacggttactccaagtgggatcatgtttacgttcagtatgatttt
gaaaaggaagttcccgtccatactgtaaaaattcatcgtaatacttatgataatgcagtc
tctacttttaaagatgttaaagtggaattgtctacaagtgtagatttttctcctgaaacc
acagaagtcattttcaaacaggcagatgtagaagaaacaattgcaaataaaggacaacct
caagtcatccaattaccagcaccaatcaatgctcgttatattcgtatttggggacggggg
cattatatccaaaatacaaacagttcatggaagggatatagtaatggcgttctctttaac
gagatagaagtcttggcgcaggttgaagcagatgctggtacgaatgaagaaccacaaacc
gagctagtcaacctcgctaaattgaaaaaaccatatttctatggtaaggctccaactaat
ccagaagccattaacgatggaaagttcgacgagaattatactactcaagaatcaataggg
gataaagcttatcttcaatacgaatttagaaatgtctatactattgaggaaatcaaggtt
cagttagctcctggagagtatcgtaatttccggatagatttggatgatgattataatgat
ggtaataattataatacaatctataagaatgaaaatttcaccattgacaaggaacagatc
ataacgattaaaactccaaaaaattctaaggcgcgttatgttcgctttagaggtacgcgc
gtagatgatactcctcttcgctattcagaaattcagattatgggacgaggaaaatcttat
gacgaatctgctccagaatatgttccaccaaaatctgaatacgatacattagtctggtct
gatgaatttaatggcgacaagattgatgaaagtaaatggcaaattattgatggcatgtgg
aatcatgcggctatatacaatcgtaaagcagtttctatcaaaaaagatggcgacaagagc
tatttgtctatccgtagcacgaaccataaggataaaaaagctttggttgaagcagttggg
cacgatcggtatgatgataaagaattaccagataaagtaacatggtcttctggtcgccta
gaatctaaagataagtattctttccaatttggtcgaatggctgttcgagctaaggtaaat
gactctaagggaatctggcctgctatttggatgttggcacaggatgagaccgggcatgac
gaaattgacgttttggaataccttggtcaaaatccatgggatgcatggacaactaaccat
tttggtattttggcaaaaaataaaaaatctgatggctcagcttataagaattacgaagct
tggagtcaggaattccatgtctacgaagtcgaatggactccagatgtcatcaaatggtat
attgatggaaaatttgtttttcaaacagaccgtggtaaggatcgggatggtatgcacacc
cgccctatgttcccgatactggaaacccaagttggtgatggctgggttggtgatgttgat
tacaaacgcaacatgactaaacaggatagtgagtacttggttgattgggttcgaatttat
caaaaagcagatcaaagtaaggtacattttgataatctagatgatgccaagcctaatgat
tatgttattaagccgcagcaaaaacttggtcacctcgtaacagtctctaacgggaaagca
gctcatgaaaacaaaaataatttctactatggaggtcaaccacgttacgaaacaagcagg
ctctatgctgatggtgatggcgaaaatgcactagtttacaagattgctaatccagaggct
ttgcacttaacaacttattacaaaacacttgaagactattctgtctataataaagaagca
ggggctaatgaaggaaaatctgttcgcaaacatttgataaatgcaaaagacggtgaaatt
gacttcactgtgtactcatctgttgacggcaaaagctggaataaagagaatgttactgta
gtggataattttgtagaagcaaccccagcttatgcacgcactacatttgatattcgcaac
attcgaaaaggtactaaatttgtgaagatcgtctttccaacggttaaaggtatttcctat
aagttggaagatggaacagagaaaggcctgcaagccagtgatgtccagttagcaaaagta
acttttgtagctactcatcctgaagcagaaccagaaaaacctattgttgatcaagaaaaa
ctagccttgtccaaagttttttcactcgatgccggtcgcaagtatttctctgtaaatcag
ataaaggagattattgatttaatttcttcttatggttacacggatatgaacctcttattg
ggaaatgatggtctgagatttttattagatgatatgaatttgaccgttggagataaggtg
tatgacagtgaagcagttagaaaagcaataataaatggtaataagcattattatgacgat
ccaaacggtacaaccttaagtcagagtgagatggatgatattcttgcttatgctaaggaa
aaaaatatttccattattccaactatcaatagcccaggtcatatggatgcgattgtagaa
gcaatggaagaattggggataaaatcgccaaaatttagttataatggcaaaacatctgca
cgtacagttgatttaaaaaatgaccaagcagttgcttttactaaagccttaattgataaa
tatgctagttactttgcaggcaaatctaaaattttcaatattggcttagatgagtatgct
aacgatgctacaaatgcttctggatggcacattcttcagacacaaggtgattatggtaag
tttattcaatatgccaatgatttagcagctatcgtcaagaagcatggtttagagccaatg
gctttcaatgatggtatctattataaccacgatactagttcgggtacttttgataaagac
attattgcttctttctggacaggaggttggggaggatatgatgttgcttcctcaaaattc
cttcatgaaaaagggcataaaattcttaatacaaatgatgcttggtactatgttattgga
cgtgaagcagaaggtttgggatggtataaccttgatcaaggtcttcgaggaactaaatca
acaaggtttgatcaagtaccgaaatctgagaatactaaggtacccattatcggtagcatg
gttgcggtatgggcagatgacccaagcaagccttacagctatgactcaattaaaaaactt
ttgcacagttttacggaaaacaattctgattatttttgggcagagtaccgagatttgcga
gaagaagttgggaagattcctactgatttaaattcctatacaccagagagcgtggcgact
ttaaaagaggtcttgaacaagattgattggaaactaagtagaaataaccaagcgtttgtt
gatggttacttggcagaagtaaaagcagcgcgtgaagcgttagttcctgtgacagcaaaa
ggagacagcgtcaaagcggagcccttaccagaaggcaagctacctctgattactgctaaa
ggaaaaagtgtccaagcagaaccacgccctgcctttaagggatacctaacctcaaactat
ggaccatctgtcacacctttatctctcgtatcaaaaccaagtagtgagcagtcacgctcc
cagcaagcagcttatcagaagaaagaattgccaaatacaggcgcagtagatggtcttgga
ttctctctccttggtatgcttggtctggcatttgctagtcgccggcggaaggaggagtaa

DBGET integrated database retrieval system