KEGG   Streptococcus suis ST3: SSUST3_0967Help
Entry
SSUST3_0967       CDS       T01470                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sst  Streptococcus suis ST3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUST3_0967
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST3_0967
   00052 Galactose metabolism
    SSUST3_0967
   00500 Starch and sucrose metabolism
    SSUST3_0967
   00520 Amino sugar and nucleotide sugar metabolism
    SSUST3_0967
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSUST3_0967
   00524 Butirosin and neomycin biosynthesis
    SSUST3_0967
Enzymes [BR:sst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSUST3_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981670..982629
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDIIDSIQHRFETHSL
TKDNFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKDQFESALGLPFFIDNDANVAAL
GEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHITVDFDEPFACTCG
KKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVFDLAKEGDDLALIV
YRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGELLLDGVRKVFAENSFPQIKESTQIV
LATRGNDAGVLGAASLVLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattatcggtattgaccttgggggaacttctgttaaattggccattttg
actactgagggagaaattcaagaaaaatggtctatcaagacaaatatattagacgatgga
agccatattgttccagatattattgacagcattcaacatcgttttgaaacccatagtttg
acaaaggacaatttcttaggaattggtatgggctcacccggtgtagtggatagtgaagct
ggcactgttatcggagcctataacctcaactggaagaccttgcaattggttaaagatcag
tttgaatctgcgctcggtttaccatttttcatcgacaatgatgcaaacgtagcggctctc
ggtgagcagtgggttggtgctggaaacaacaatccaaacgttgtctttatgacgcttggt
acaggtgtcggtggcggtgtcatcgctgctggaaacttgattcgtggggtcaaaggcgct
ggtggtgaattgggccatatcacagttgactttgatgagccatttgcatgtacttgtggt
aagaaaggttgcttggaaaccgtggcttcagcgacaggtattgtcaaccttagccgtcgt
tatgcggaccaatacgcaggcgatgcaaaactgaaacaaatgattgatgatgggcaagat
gtaacggctaaagatgtctttgatttggcaaaagaaggcgatgatttggctttgattgtc
taccgtcacttctcagaatacctaggtgttgcttgtgcaaacattgctgcagtcctcaat
cctgcctacatcgttctgggtggcggtgtatcagctgcaggagagctcttattggatggt
gttcgtaaagtctttgctgaaaatagcttcccacaaatcaaggaaagcacgcaaattgtc
ttggcaacacgtggtaatgatgcaggtgtattgggcgcagcatcacttgtcttgaaataa

DBGET integrated database retrieval system